BLASTX nr result
ID: Cocculus23_contig00013014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00013014 (894 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511382.1| conserved hypothetical protein [Ricinus comm... 59 3e-06 >ref|XP_002511382.1| conserved hypothetical protein [Ricinus communis] gi|223550497|gb|EEF51984.1| conserved hypothetical protein [Ricinus communis] Length = 1061 Score = 58.5 bits (140), Expect = 3e-06 Identities = 40/115 (34%), Positives = 51/115 (44%) Frame = +1 Query: 445 MINGEEGGKVKSDPPSPDPLEGFAPWLDQRXXXXXXXXXXXXXXXXXXXXXXXRYCSANS 624 MINGE P SPDP + F P + RYCSANS Sbjct: 1 MINGE-------GPASPDPFDSFTP----KTTDDVSPGSLSRYSSCGGESEFERYCSANS 49 Query: 625 VLGTASFCSSLGTCNEFLDSDLWSLKNLEFGNERILESFGSHENLGRNSGDRSIA 789 V+GT SFCSS G N+ ++S+ SLK+LE S G RNS + ++ Sbjct: 50 VMGTPSFCSSFGPANDRIESEFGSLKSLE------NFSLGGRLKFDRNSEEHKLS 98