BLASTX nr result
ID: Cocculus23_contig00012853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00012853 (1282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC09145.1| hypothetical protein L484_005097 [Morus notabilis] 94 1e-16 ref|NP_565456.2| WD-40 repeat-containing protein MSI4 [Arabidops... 94 1e-16 ref|XP_006466032.1| PREDICTED: WD-40 repeat-containing protein M... 94 1e-16 ref|XP_007138727.1| hypothetical protein PHAVU_009G232200g [Phas... 94 1e-16 ref|XP_006451474.1| hypothetical protein CICLE_v10008090mg [Citr... 94 1e-16 ref|XP_006451473.1| hypothetical protein CICLE_v10008090mg [Citr... 94 1e-16 ref|XP_006451472.1| hypothetical protein CICLE_v10008090mg [Citr... 94 1e-16 ref|XP_006426544.1| hypothetical protein CICLE_v10025540mg [Citr... 94 1e-16 ref|XP_006426543.1| hypothetical protein CICLE_v10025540mg [Citr... 94 1e-16 ref|XP_006426542.1| hypothetical protein CICLE_v10025540mg [Citr... 94 1e-16 ref|XP_006409039.1| hypothetical protein EUTSA_v10022653mg [Eutr... 94 1e-16 ref|XP_006826731.1| hypothetical protein AMTR_s00136p00031470 [A... 94 1e-16 ref|XP_007012838.1| Transducin family protein / WD-40 repeat fam... 94 1e-16 ref|XP_004488042.1| PREDICTED: WD-40 repeat-containing protein M... 94 1e-16 ref|XP_006300000.1| hypothetical protein CARUB_v10016223mg [Caps... 94 1e-16 ref|XP_007215336.1| hypothetical protein PRUPE_ppa005299mg [Prun... 94 1e-16 ref|XP_007201952.1| hypothetical protein PRUPE_ppa004586mg [Prun... 94 1e-16 gb|AGG38122.1| FVE-2 protein [Dimocarpus longan] 94 1e-16 gb|AGG11792.1| FVE-3 variant [Dimocarpus longan] 94 1e-16 ref|XP_004158447.1| PREDICTED: WD-40 repeat-containing protein M... 94 1e-16 >gb|EXC09145.1| hypothetical protein L484_005097 [Morus notabilis] Length = 466 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 36 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 81 >ref|NP_565456.2| WD-40 repeat-containing protein MSI4 [Arabidopsis thaliana] gi|22096353|sp|O22607.3|MSI4_ARATH RecName: Full=WD-40 repeat-containing protein MSI4; AltName: Full=Altered cold-responsive gene 1 protein gi|30268748|gb|AAP29474.1|AF498101_1 MSI4 [Arabidopsis thaliana] gi|30268750|gb|AAP29475.1|AF498102_1 MSI4 [Arabidopsis thaliana] gi|16323103|gb|AAL15286.1| At2g19520/F3P11.12 [Arabidopsis thaliana] gi|16648859|gb|AAL24281.1| putative WD-40 repeat protein, MSI4 [Arabidopsis thaliana] gi|20148237|gb|AAM10009.1| putative WD-40 repeat protein, MSI4 [Arabidopsis thaliana] gi|61661316|gb|AAX51264.1| FVE [Arabidopsis thaliana] gi|330251797|gb|AEC06891.1| WD-40 repeat-containing protein MSI4 [Arabidopsis thaliana] Length = 507 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 88 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 133 >ref|XP_006466032.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Citrus sinensis] Length = 469 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 36 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 81 >ref|XP_007138727.1| hypothetical protein PHAVU_009G232200g [Phaseolus vulgaris] gi|561011814|gb|ESW10721.1| hypothetical protein PHAVU_009G232200g [Phaseolus vulgaris] Length = 500 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 78 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 123 >ref|XP_006451474.1| hypothetical protein CICLE_v10008090mg [Citrus clementina] gi|568843093|ref|XP_006475456.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Citrus sinensis] gi|557554700|gb|ESR64714.1| hypothetical protein CICLE_v10008090mg [Citrus clementina] Length = 496 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 64 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 109 >ref|XP_006451473.1| hypothetical protein CICLE_v10008090mg [Citrus clementina] gi|557554699|gb|ESR64713.1| hypothetical protein CICLE_v10008090mg [Citrus clementina] Length = 448 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 64 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 109 >ref|XP_006451472.1| hypothetical protein CICLE_v10008090mg [Citrus clementina] gi|557554698|gb|ESR64712.1| hypothetical protein CICLE_v10008090mg [Citrus clementina] Length = 490 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 64 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 109 >ref|XP_006426544.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] gi|557528534|gb|ESR39784.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] Length = 326 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 36 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 81 >ref|XP_006426543.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] gi|557528533|gb|ESR39783.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] Length = 469 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 36 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 81 >ref|XP_006426542.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] gi|557528532|gb|ESR39782.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] Length = 464 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 36 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 81 >ref|XP_006409039.1| hypothetical protein EUTSA_v10022653mg [Eutrema salsugineum] gi|557110201|gb|ESQ50492.1| hypothetical protein EUTSA_v10022653mg [Eutrema salsugineum] Length = 510 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 91 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 136 >ref|XP_006826731.1| hypothetical protein AMTR_s00136p00031470 [Amborella trichopoda] gi|548831151|gb|ERM93968.1| hypothetical protein AMTR_s00136p00031470 [Amborella trichopoda] Length = 470 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 36 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 81 >ref|XP_007012838.1| Transducin family protein / WD-40 repeat family protein [Theobroma cacao] gi|508783201|gb|EOY30457.1| Transducin family protein / WD-40 repeat family protein [Theobroma cacao] Length = 502 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 79 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 124 >ref|XP_004488042.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Cicer arietinum] Length = 517 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 89 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 134 >ref|XP_006300000.1| hypothetical protein CARUB_v10016223mg [Capsella rubella] gi|482568709|gb|EOA32898.1| hypothetical protein CARUB_v10016223mg [Capsella rubella] Length = 503 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 88 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 133 >ref|XP_007215336.1| hypothetical protein PRUPE_ppa005299mg [Prunus persica] gi|462411486|gb|EMJ16535.1| hypothetical protein PRUPE_ppa005299mg [Prunus persica] Length = 468 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 37 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 82 >ref|XP_007201952.1| hypothetical protein PRUPE_ppa004586mg [Prunus persica] gi|462397483|gb|EMJ03151.1| hypothetical protein PRUPE_ppa004586mg [Prunus persica] Length = 502 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 72 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 117 >gb|AGG38122.1| FVE-2 protein [Dimocarpus longan] Length = 483 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 65 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 110 >gb|AGG11792.1| FVE-3 variant [Dimocarpus longan] Length = 136 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 65 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 110 >ref|XP_004158447.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Cucumis sativus] Length = 518 Score = 94.4 bits (233), Expect = 1e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 VWPSLSCRWGPQIEQAIYKNKQRLYLSEQTDGSFPNTLVIANCEVV 139 VWPSLSCRWGPQ+EQA YKN+QRLYLSEQTDGS PNTLVIANCEVV Sbjct: 89 VWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVV 134