BLASTX nr result
ID: Cocculus23_contig00012694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00012694 (771 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007024352.1| Poly(A) binding protein 6, putative isoform ... 59 3e-06 ref|XP_007024351.1| Poly(A) binding protein 6, putative isoform ... 59 3e-06 ref|XP_007024350.1| Poly(A) binding protein 6, putative isoform ... 59 3e-06 ref|XP_002277538.1| PREDICTED: polyadenylate-binding protein, cy... 57 6e-06 emb|CBI36032.3| unnamed protein product [Vitis vinifera] 57 6e-06 emb|CAN65531.1| hypothetical protein VITISV_039630 [Vitis vinifera] 57 6e-06 >ref|XP_007024352.1| Poly(A) binding protein 6, putative isoform 3 [Theobroma cacao] gi|508779718|gb|EOY26974.1| Poly(A) binding protein 6, putative isoform 3 [Theobroma cacao] Length = 625 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 385 LDCMVAEEDGKSKGFGFVQFVSEESAMSVLNSLDGTFVQGK 507 L C VAEE+GKSKGFGFVQF SEESA + + +L GT ++GK Sbjct: 149 LSCKVAEENGKSKGFGFVQFDSEESAKAAITALHGTMLEGK 189 >ref|XP_007024351.1| Poly(A) binding protein 6, putative isoform 2 [Theobroma cacao] gi|508779717|gb|EOY26973.1| Poly(A) binding protein 6, putative isoform 2 [Theobroma cacao] Length = 474 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 385 LDCMVAEEDGKSKGFGFVQFVSEESAMSVLNSLDGTFVQGK 507 L C VAEE+GKSKGFGFVQF SEESA + + +L GT ++GK Sbjct: 42 LSCKVAEENGKSKGFGFVQFDSEESAKAAITALHGTMLEGK 82 >ref|XP_007024350.1| Poly(A) binding protein 6, putative isoform 1 [Theobroma cacao] gi|508779716|gb|EOY26972.1| Poly(A) binding protein 6, putative isoform 1 [Theobroma cacao] Length = 577 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 385 LDCMVAEEDGKSKGFGFVQFVSEESAMSVLNSLDGTFVQGK 507 L C VAEE+GKSKGFGFVQF SEESA + + +L GT ++GK Sbjct: 149 LSCKVAEENGKSKGFGFVQFDSEESAKAAITALHGTMLEGK 189 >ref|XP_002277538.1| PREDICTED: polyadenylate-binding protein, cytoplasmic and nuclear-like [Vitis vinifera] Length = 630 Score = 57.4 bits (137), Expect = 6e-06 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +1 Query: 355 ALQDLLCS--KHLDCMVAEEDGKSKGFGFVQFVSEESAMSVLNSLDGTFVQGK 507 +LQD+ C L C VAEE+GKSK FGFVQF S++SA + LN+L+ T + GK Sbjct: 132 SLQDIFCKFGNILSCKVAEENGKSKCFGFVQFDSDDSATAALNALNDTMLDGK 184 >emb|CBI36032.3| unnamed protein product [Vitis vinifera] Length = 476 Score = 57.4 bits (137), Expect = 6e-06 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +1 Query: 355 ALQDLLCS--KHLDCMVAEEDGKSKGFGFVQFVSEESAMSVLNSLDGTFVQGK 507 +LQD+ C L C VAEE+GKSK FGFVQF S++SA + LN+L+ T + GK Sbjct: 132 SLQDIFCKFGNILSCKVAEENGKSKCFGFVQFDSDDSATAALNALNDTMLDGK 184 >emb|CAN65531.1| hypothetical protein VITISV_039630 [Vitis vinifera] Length = 555 Score = 57.4 bits (137), Expect = 6e-06 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +1 Query: 355 ALQDLLCS--KHLDCMVAEEDGKSKGFGFVQFVSEESAMSVLNSLDGTFVQGK 507 +LQD+ C L C VAEE+GKSK FGFVQF S++SA + LN+L+ T + GK Sbjct: 132 SLQDIFCKFGNILSCKVAEENGKSKCFGFVQFDSDDSATAALNALNDTMLDGK 184