BLASTX nr result
ID: Cocculus23_contig00012550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00012550 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851481.1| hypothetical protein AMTR_s00040p00136460 [A... 67 3e-09 ref|XP_002313608.1| OTU-like cysteine protease family protein [P... 67 3e-09 gb|AFW58196.1| hypothetical protein ZEAMMB73_220514 [Zea mays] 67 3e-09 gb|ACL53546.1| unknown [Zea mays] gi|223946639|gb|ACN27403.1| un... 67 3e-09 gb|ACF81551.1| unknown [Zea mays] 67 3e-09 ref|XP_003596867.1| OTU domain-containing protein [Medicago trun... 66 4e-09 ref|XP_006384751.1| hypothetical protein POPTR_0004s20770g [Popu... 65 1e-08 ref|XP_004975581.1| PREDICTED: OTU domain-containing protein 5-B... 65 1e-08 ref|XP_004487483.1| PREDICTED: OTU domain-containing protein 5-l... 65 1e-08 ref|XP_004487480.1| PREDICTED: OTU domain-containing protein 5-l... 65 1e-08 ref|XP_007132462.1| hypothetical protein PHAVU_011G096000g [Phas... 64 3e-08 ref|XP_003539838.1| PREDICTED: OTU domain-containing protein 5-l... 64 3e-08 ref|XP_003538105.1| PREDICTED: OTU domain-containing protein 5-l... 64 3e-08 ref|XP_003580577.1| PREDICTED: uncharacterized protein LOC100823... 63 4e-08 ref|XP_002523840.1| expressed protein, putative [Ricinus communi... 63 4e-08 ref|XP_006487915.1| PREDICTED: OTU domain-containing protein 5-B... 63 5e-08 ref|XP_006422365.1| hypothetical protein CICLE_v10018416mg [Citr... 63 5e-08 ref|XP_006422364.1| hypothetical protein CICLE_v10018416mg [Citr... 63 5e-08 gb|EMS60271.1| hypothetical protein TRIUR3_34891 [Triticum urartu] 62 6e-08 ref|XP_004291697.1| PREDICTED: uncharacterized protein LOC101291... 62 8e-08 >ref|XP_006851481.1| hypothetical protein AMTR_s00040p00136460 [Amborella trichopoda] gi|548855175|gb|ERN13062.1| hypothetical protein AMTR_s00040p00136460 [Amborella trichopoda] Length = 556 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y + IEAYSIFG+DV+SM+CYLLE GS+S + G++NRLKGKA E Sbjct: 513 YRKVIEAYSIFGNDVESMVCYLLEMGSASPSEGTLNRLKGKATE 556 >ref|XP_002313608.1| OTU-like cysteine protease family protein [Populus trichocarpa] gi|222850016|gb|EEE87563.1| OTU-like cysteine protease family protein [Populus trichocarpa] Length = 534 Score = 67.0 bits (162), Expect = 3e-09 Identities = 40/76 (52%), Positives = 44/76 (57%) Frame = -2 Query: 258 SDSKPVDGKESSQSNNRVXXXXXXXXXXXXXSYLQAIEAYSIFGDDVDSMICYLLETGSS 79 S++ VDG S + V SYLQ IEAYSIFGDDVDSM+CYLLETGSS Sbjct: 466 SETSKVDGVREHGSQDTVLSSSMQMVLSMGFSYLQVIEAYSIFGDDVDSMVCYLLETGSS 525 Query: 78 STASGSINRLKGKAME 31 S R KGKA E Sbjct: 526 S-------RRKGKATE 534 >gb|AFW58196.1| hypothetical protein ZEAMMB73_220514 [Zea mays] Length = 553 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+Q +EAYSIFG+DVDSM+CYLLETG + ++G NR KGKA E Sbjct: 510 YIQVMEAYSIFGEDVDSMVCYLLETGGTGASAGGSNRRKGKAAE 553 >gb|ACL53546.1| unknown [Zea mays] gi|223946639|gb|ACN27403.1| unknown [Zea mays] gi|413918265|gb|AFW58197.1| hypothetical protein ZEAMMB73_220514 [Zea mays] gi|413918266|gb|AFW58198.1| hypothetical protein ZEAMMB73_220514 [Zea mays] gi|413918267|gb|AFW58199.1| hypothetical protein ZEAMMB73_220514 [Zea mays] gi|413918268|gb|AFW58200.1| hypothetical protein ZEAMMB73_220514 [Zea mays] Length = 539 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+Q +EAYSIFG+DVDSM+CYLLETG + ++G NR KGKA E Sbjct: 496 YIQVMEAYSIFGEDVDSMVCYLLETGGTGASAGGSNRRKGKAAE 539 >gb|ACF81551.1| unknown [Zea mays] Length = 54 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+Q +EAYSIFG+DVDSM+CYLLETG + ++G NR KGKA E Sbjct: 11 YIQVMEAYSIFGEDVDSMVCYLLETGGTGASAGGSNRRKGKAAE 54 >ref|XP_003596867.1| OTU domain-containing protein [Medicago truncatula] gi|355485915|gb|AES67118.1| OTU domain-containing protein [Medicago truncatula] Length = 253 Score = 66.2 bits (160), Expect = 4e-09 Identities = 40/67 (59%), Positives = 41/67 (61%) Frame = -2 Query: 231 ESSQSNNRVXXXXXXXXXXXXXSYLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINR 52 ES + NN SYLQAIEAYSIFGDDVDSMICYLLETGSSS R Sbjct: 194 ESGKGNNSNLSSSMNMLLSMGFSYLQAIEAYSIFGDDVDSMICYLLETGSSS-------R 246 Query: 51 LKGKAME 31 KGKA E Sbjct: 247 RKGKATE 253 >ref|XP_006384751.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] gi|566167651|ref|XP_006384752.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] gi|550341519|gb|ERP62548.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] gi|550341520|gb|ERP62549.1| hypothetical protein POPTR_0004s20770g [Populus trichocarpa] Length = 535 Score = 65.1 bits (157), Expect = 1e-08 Identities = 38/76 (50%), Positives = 46/76 (60%) Frame = -2 Query: 258 SDSKPVDGKESSQSNNRVXXXXXXXXXXXXXSYLQAIEAYSIFGDDVDSMICYLLETGSS 79 S++ V+G S + V SYLQAIEAYSIFGDDVDSM+CYL+ET SS Sbjct: 465 SETTKVEGAREHGSQDTVLSSSMQIVLSMGFSYLQAIEAYSIFGDDVDSMVCYLVETSSS 524 Query: 78 STASGSINRLKGKAME 31 S+ +R KGKA E Sbjct: 525 SS-----SRRKGKATE 535 >ref|XP_004975581.1| PREDICTED: OTU domain-containing protein 5-B-like [Setaria italica] Length = 541 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+Q +EAYSIFG+DVDSMICYL+ETG + G NR KGKA E Sbjct: 498 YIQVMEAYSIFGEDVDSMICYLVETGGPGASEGGSNRRKGKAAE 541 >ref|XP_004487483.1| PREDICTED: OTU domain-containing protein 5-like isoform X4 [Cicer arietinum] Length = 532 Score = 64.7 bits (156), Expect = 1e-08 Identities = 45/82 (54%), Positives = 46/82 (56%), Gaps = 6/82 (7%) Frame = -2 Query: 258 SDSKPVDGKE------SSQSNNRVXXXXXXXXXXXXXSYLQAIEAYSIFGDDVDSMICYL 97 SD K GKE SS S N V YLQAIEAYSIFGDDVDSM+CYL Sbjct: 466 SDPKMERGKENDSDLSSSSSMNMVLSMGFS--------YLQAIEAYSIFGDDVDSMVCYL 517 Query: 96 LETGSSSTASGSINRLKGKAME 31 LETGSSS R KGKA E Sbjct: 518 LETGSSS-------RRKGKATE 532 >ref|XP_004487480.1| PREDICTED: OTU domain-containing protein 5-like isoform X1 [Cicer arietinum] gi|502083508|ref|XP_004487481.1| PREDICTED: OTU domain-containing protein 5-like isoform X2 [Cicer arietinum] gi|502083511|ref|XP_004487482.1| PREDICTED: OTU domain-containing protein 5-like isoform X3 [Cicer arietinum] Length = 533 Score = 64.7 bits (156), Expect = 1e-08 Identities = 45/82 (54%), Positives = 46/82 (56%), Gaps = 6/82 (7%) Frame = -2 Query: 258 SDSKPVDGKE------SSQSNNRVXXXXXXXXXXXXXSYLQAIEAYSIFGDDVDSMICYL 97 SD K GKE SS S N V YLQAIEAYSIFGDDVDSM+CYL Sbjct: 467 SDPKMERGKENDSDLSSSSSMNMVLSMGFS--------YLQAIEAYSIFGDDVDSMVCYL 518 Query: 96 LETGSSSTASGSINRLKGKAME 31 LETGSSS R KGKA E Sbjct: 519 LETGSSS-------RRKGKATE 533 >ref|XP_007132462.1| hypothetical protein PHAVU_011G096000g [Phaseolus vulgaris] gi|561005462|gb|ESW04456.1| hypothetical protein PHAVU_011G096000g [Phaseolus vulgaris] Length = 513 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+QAIEAYSIFGDDVDSM+CYLLETGSSS R KGKA E Sbjct: 477 YIQAIEAYSIFGDDVDSMVCYLLETGSSS-------RRKGKATE 513 >ref|XP_003539838.1| PREDICTED: OTU domain-containing protein 5-like isoform X1 [Glycine max] gi|571492760|ref|XP_006592338.1| PREDICTED: OTU domain-containing protein 5-like isoform X2 [Glycine max] Length = 519 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+QAIEAYSIFGDDVDSM+CYLLETGSSS R KGKA E Sbjct: 483 YMQAIEAYSIFGDDVDSMVCYLLETGSSS-------RRKGKATE 519 >ref|XP_003538105.1| PREDICTED: OTU domain-containing protein 5-like isoform X1 [Glycine max] gi|571488924|ref|XP_006591068.1| PREDICTED: OTU domain-containing protein 5-like isoform X2 [Glycine max] gi|571488926|ref|XP_006591069.1| PREDICTED: OTU domain-containing protein 5-like isoform X3 [Glycine max] gi|571488928|ref|XP_006591070.1| PREDICTED: OTU domain-containing protein 5-like isoform X4 [Glycine max] Length = 520 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+QAIEAYSIFGDDVDSM+CYLLETGSSS R KGKA E Sbjct: 484 YMQAIEAYSIFGDDVDSMVCYLLETGSSS-------RRKGKATE 520 >ref|XP_003580577.1| PREDICTED: uncharacterized protein LOC100823428 [Brachypodium distachyon] Length = 537 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+Q +EAYSIFG+DVDSMICYL+E G + ++G NR KGKA E Sbjct: 494 YMQVMEAYSIFGEDVDSMICYLVEMGGTGPSAGGSNRRKGKAAE 537 >ref|XP_002523840.1| expressed protein, putative [Ricinus communis] gi|223536928|gb|EEF38566.1| expressed protein, putative [Ricinus communis] Length = 534 Score = 63.2 bits (152), Expect = 4e-08 Identities = 40/77 (51%), Positives = 46/77 (59%), Gaps = 1/77 (1%) Frame = -2 Query: 258 SDSKP-VDGKESSQSNNRVXXXXXXXXXXXXXSYLQAIEAYSIFGDDVDSMICYLLETGS 82 SDS+ V+G ++ + V SYLQAIEAYSIFGDDVDSM+CYLLET S Sbjct: 465 SDSETKVEGTRTNSLQDTVLSSSMQMVLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETAS 524 Query: 81 SSTASGSINRLKGKAME 31 SS R KGKA E Sbjct: 525 SS-------RRKGKATE 534 >ref|XP_006487915.1| PREDICTED: OTU domain-containing protein 5-B-like isoform X1 [Citrus sinensis] gi|568869402|ref|XP_006487916.1| PREDICTED: OTU domain-containing protein 5-B-like isoform X2 [Citrus sinensis] Length = 535 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 YLQ IEAYSIFGDDVDSM+CYLLETGSSS R KGKA E Sbjct: 499 YLQVIEAYSIFGDDVDSMVCYLLETGSSS-------RRKGKATE 535 >ref|XP_006422365.1| hypothetical protein CICLE_v10018416mg [Citrus clementina] gi|557524287|gb|ESR35605.1| hypothetical protein CICLE_v10018416mg [Citrus clementina] Length = 214 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 YLQ IEAYSIFGDDVDSM+CYLLETGSSS R KGKA E Sbjct: 178 YLQVIEAYSIFGDDVDSMVCYLLETGSSS-------RRKGKATE 214 >ref|XP_006422364.1| hypothetical protein CICLE_v10018416mg [Citrus clementina] gi|557524286|gb|ESR35604.1| hypothetical protein CICLE_v10018416mg [Citrus clementina] Length = 172 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 YLQ IEAYSIFGDDVDSM+CYLLETGSSS R KGKA E Sbjct: 136 YLQVIEAYSIFGDDVDSMVCYLLETGSSS-------RRKGKATE 172 >gb|EMS60271.1| hypothetical protein TRIUR3_34891 [Triticum urartu] Length = 549 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 Y+Q +EAYSIFG+D+DSMICYL+E G + ++G NR KGKA E Sbjct: 506 YMQVMEAYSIFGEDMDSMICYLVEMGGTGASAGGSNRRKGKAAE 549 >ref|XP_004291697.1| PREDICTED: uncharacterized protein LOC101291693 [Fragaria vesca subsp. vesca] Length = 535 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = -2 Query: 162 YLQAIEAYSIFGDDVDSMICYLLETGSSSTASGSINRLKGKAME 31 YLQAIEAYSIFGDDVDSM+CYLLET SSS R KGKA E Sbjct: 499 YLQAIEAYSIFGDDVDSMVCYLLETSSSS-------RRKGKATE 535