BLASTX nr result
ID: Cocculus23_contig00012501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00012501 (611 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521862.1| conserved hypothetical protein [Ricinus comm... 59 8e-07 ref|XP_006346453.1| PREDICTED: vitellogenin-A2-like [Solanum tub... 59 1e-06 ref|XP_006829414.1| hypothetical protein AMTR_s00128p00093480 [A... 59 1e-06 ref|XP_006409529.1| hypothetical protein EUTSA_v10022784mg [Eutr... 58 2e-06 ref|NP_565379.1| uncharacterized protein [Arabidopsis thaliana] ... 58 2e-06 ref|XP_002885977.1| calmodulin-binding protein [Arabidopsis lyra... 58 2e-06 ref|XP_006480132.1| PREDICTED: uncharacterized protein LOC102608... 57 3e-06 ref|XP_006423057.1| hypothetical protein CICLE_v10028742mg [Citr... 57 3e-06 gb|EXC17370.1| hypothetical protein L484_027562 [Morus notabilis] 56 7e-06 ref|XP_004231405.1| PREDICTED: uncharacterized protein LOC101262... 56 9e-06 >ref|XP_002521862.1| conserved hypothetical protein [Ricinus communis] gi|223538900|gb|EEF40498.1| conserved hypothetical protein [Ricinus communis] Length = 382 Score = 59.3 bits (142), Expect = 8e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 611 ANRAVSEGLKKKTFLPYKQGLFGCMGFNPAVQGFGR 504 ANRAVSE +K+KTFLPYKQGL GC+GFNP V R Sbjct: 339 ANRAVSEEMKRKTFLPYKQGLLGCLGFNPGVHEISR 374 >ref|XP_006346453.1| PREDICTED: vitellogenin-A2-like [Solanum tuberosum] Length = 324 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 608 NRAVSEGLKKKTFLPYKQGLFGCMGFNPAVQ 516 NRAVSE +KKKTFLPYKQGL GC+GFNP++Q Sbjct: 278 NRAVSEEMKKKTFLPYKQGLLGCLGFNPSLQ 308 >ref|XP_006829414.1| hypothetical protein AMTR_s00128p00093480 [Amborella trichopoda] gi|548834768|gb|ERM96830.1| hypothetical protein AMTR_s00128p00093480 [Amborella trichopoda] Length = 374 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 611 ANRAVSEGLKKKTFLPYKQGLFGCMGFNPAVQGFGRRF 498 A+RA SE L+KKTFLPY+QGLFGC+G++P + G R F Sbjct: 336 ASRAFSEELRKKTFLPYRQGLFGCLGYSPTIHGLARGF 373 >ref|XP_006409529.1| hypothetical protein EUTSA_v10022784mg [Eutrema salsugineum] gi|557110691|gb|ESQ50982.1| hypothetical protein EUTSA_v10022784mg [Eutrema salsugineum] Length = 315 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 608 NRAVSEGLKKKTFLPYKQGLFGCMGFNPAVQGFGR 504 NRAVSE LK+KTFLPYKQG GC+GFNPAV R Sbjct: 272 NRAVSEELKRKTFLPYKQGWLGCLGFNPAVHEIAR 306 >ref|NP_565379.1| uncharacterized protein [Arabidopsis thaliana] gi|13569554|gb|AAK31147.1|AF345343_1 unknown [Arabidopsis thaliana] gi|5306255|gb|AAD41988.1| expressed protein [Arabidopsis thaliana] gi|20197707|gb|AAM15217.1| expressed protein [Arabidopsis thaliana] gi|21593841|gb|AAM65808.1| unknown [Arabidopsis thaliana] gi|111074358|gb|ABH04552.1| At2g15760 [Arabidopsis thaliana] gi|330251341|gb|AEC06435.1| uncharacterized protein AT2G15760 [Arabidopsis thaliana] Length = 315 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 608 NRAVSEGLKKKTFLPYKQGLFGCMGFNPAVQGFGR 504 NRAVSE LK+KTFLPYKQG GC+GFNPAV R Sbjct: 272 NRAVSEELKRKTFLPYKQGWLGCLGFNPAVNEIAR 306 >ref|XP_002885977.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata] gi|297331817|gb|EFH62236.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata] Length = 317 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 608 NRAVSEGLKKKTFLPYKQGLFGCMGFNPAVQGFGR 504 NRAVSE LK+KTFLPYKQG GC+GFNPAV R Sbjct: 274 NRAVSEELKRKTFLPYKQGWLGCLGFNPAVNEIAR 308 >ref|XP_006480132.1| PREDICTED: uncharacterized protein LOC102608722 [Citrus sinensis] Length = 352 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 611 ANRAVSEGLKKKTFLPYKQGLFGCMGFNP 525 ANRAVSE LK+KTFLPYKQGL GC+GFNP Sbjct: 308 ANRAVSEELKRKTFLPYKQGLLGCLGFNP 336 >ref|XP_006423057.1| hypothetical protein CICLE_v10028742mg [Citrus clementina] gi|557524991|gb|ESR36297.1| hypothetical protein CICLE_v10028742mg [Citrus clementina] Length = 350 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 611 ANRAVSEGLKKKTFLPYKQGLFGCMGFNP 525 ANRAVSE LK+KTFLPYKQGL GC+GFNP Sbjct: 306 ANRAVSEELKRKTFLPYKQGLLGCLGFNP 334 >gb|EXC17370.1| hypothetical protein L484_027562 [Morus notabilis] Length = 384 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 608 NRAVSEGLKKKTFLPYKQGLFGCMGFNPAV 519 NRA SE +KKKTFLPYKQGL GC+GFNP V Sbjct: 339 NRAASEEMKKKTFLPYKQGLLGCLGFNPGV 368 >ref|XP_004231405.1| PREDICTED: uncharacterized protein LOC101262366 [Solanum lycopersicum] Length = 298 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 608 NRAVSEGLKKKTFLPYKQGLFGCMGFNPAVQ 516 NRAVSE +KKKTFLPYKQGL GC+GFN ++Q Sbjct: 252 NRAVSEEMKKKTFLPYKQGLLGCLGFNASLQ 282