BLASTX nr result
ID: Cocculus23_contig00012122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00012122 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006443692.1| hypothetical protein CICLE_v10022530mg [Citr... 74 2e-11 ref|XP_006443689.1| hypothetical protein CICLE_v10022530mg [Citr... 74 2e-11 ref|XP_002525351.1| glutaredoxin, grx, putative [Ricinus communi... 74 2e-11 ref|XP_006352722.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 72 1e-10 ref|XP_002267052.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 70 2e-10 ref|XP_004242377.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 70 4e-10 ref|XP_007201404.1| hypothetical protein PRUPE_ppa012249mg [Prun... 69 9e-10 gb|EXB46054.1| Glutaredoxin-C5 [Morus notabilis] 68 2e-09 ref|XP_007050087.1| Glutaredoxin family protein isoform 3 [Theob... 67 2e-09 ref|XP_007050085.1| Glutaredoxin family protein isoform 1 [Theob... 67 2e-09 gb|EXB64479.1| Bifunctional 3-dehydroquinate dehydratase/shikima... 64 3e-08 ref|XP_006854323.1| hypothetical protein AMTR_s00039p00123020, p... 63 5e-08 ref|XP_006408941.1| hypothetical protein EUTSA_v10002105mg [Eutr... 62 6e-08 ref|XP_002521163.1| glutaredoxin, grx, putative [Ricinus communi... 62 6e-08 emb|CBI37229.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_003542446.2| PREDICTED: glutaredoxin-C5, chloroplastic is... 62 8e-08 ref|XP_004290010.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 62 1e-07 pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12... 60 3e-07 ref|XP_002303098.2| glutaredoxin family protein [Populus trichoc... 59 5e-07 gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremu... 59 5e-07 >ref|XP_006443692.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|557545954|gb|ESR56932.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] Length = 144 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/66 (57%), Positives = 46/66 (69%) Frame = +2 Query: 197 SQKFHKLGSRRRIDDNDLRSTYFGRRGAFVVRAMTASFGSRLEENVKKTVSENPVVVFSK 376 + ++ SR + N R Y GA V+AM +SFGSRLEE+VKKTVSENPVVV+SK Sbjct: 34 ANNYYTFSSRTSLSVNGRRRRY----GALSVQAMASSFGSRLEESVKKTVSENPVVVYSK 89 Query: 377 TWCSYS 394 TWCSYS Sbjct: 90 TWCSYS 95 >ref|XP_006443689.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|567902404|ref|XP_006443690.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|567902406|ref|XP_006443691.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|568853006|ref|XP_006480159.1| PREDICTED: glutaredoxin-C5, chloroplastic-like isoform X1 [Citrus sinensis] gi|557545951|gb|ESR56929.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|557545952|gb|ESR56930.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|557545953|gb|ESR56931.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] Length = 174 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/66 (57%), Positives = 46/66 (69%) Frame = +2 Query: 197 SQKFHKLGSRRRIDDNDLRSTYFGRRGAFVVRAMTASFGSRLEENVKKTVSENPVVVFSK 376 + ++ SR + N R Y GA V+AM +SFGSRLEE+VKKTVSENPVVV+SK Sbjct: 34 ANNYYTFSSRTSLSVNGRRRRY----GALSVQAMASSFGSRLEESVKKTVSENPVVVYSK 89 Query: 377 TWCSYS 394 TWCSYS Sbjct: 90 TWCSYS 95 >ref|XP_002525351.1| glutaredoxin, grx, putative [Ricinus communis] gi|223535314|gb|EEF36989.1| glutaredoxin, grx, putative [Ricinus communis] Length = 165 Score = 73.9 bits (180), Expect = 2e-11 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 1/73 (1%) Frame = +2 Query: 179 LCNLSF-SQKFHKLGSRRRIDDNDLRSTYFGRRGAFVVRAMTASFGSRLEENVKKTVSEN 355 LCN+S S F+ R L ++ + G VRAMT+SFGSRLEE+VKKTV EN Sbjct: 23 LCNISTPSFPFNNNNLRTTTTTTILGASGSRKHGPVSVRAMTSSFGSRLEESVKKTVDEN 82 Query: 356 PVVVFSKTWCSYS 394 PVVV+SKTWCSYS Sbjct: 83 PVVVYSKTWCSYS 95 >ref|XP_006352722.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Solanum tuberosum] Length = 183 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/66 (56%), Positives = 48/66 (72%) Frame = +2 Query: 197 SQKFHKLGSRRRIDDNDLRSTYFGRRGAFVVRAMTASFGSRLEENVKKTVSENPVVVFSK 376 S + H+ GSR I++N R G +RAM+ SFGSRLEE+VKKT++ENPVVV+SK Sbjct: 44 SVRLHRFGSR--IENNGPRKI-----GRVQIRAMSGSFGSRLEESVKKTITENPVVVYSK 96 Query: 377 TWCSYS 394 +WCSYS Sbjct: 97 SWCSYS 102 >ref|XP_002267052.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Vitis vinifera] Length = 178 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +2 Query: 269 RRGAFVVRAMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 R G +VRAM +SFGSRLEE VKKTV ENPVVV+SKTWCSYS Sbjct: 56 RYGPVLVRAMASSFGSRLEETVKKTVDENPVVVYSKTWCSYS 97 >ref|XP_004242377.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Solanum lycopersicum] Length = 183 Score = 69.7 bits (169), Expect = 4e-10 Identities = 36/66 (54%), Positives = 48/66 (72%) Frame = +2 Query: 197 SQKFHKLGSRRRIDDNDLRSTYFGRRGAFVVRAMTASFGSRLEENVKKTVSENPVVVFSK 376 S + H+ GSR I+++ R G +RAM+ SFGSRLEE+VKKT++ENPVVV+SK Sbjct: 44 SVRLHRFGSR--IENDGPRKI-----GRVQIRAMSGSFGSRLEESVKKTITENPVVVYSK 96 Query: 377 TWCSYS 394 +WCSYS Sbjct: 97 SWCSYS 102 >ref|XP_007201404.1| hypothetical protein PRUPE_ppa012249mg [Prunus persica] gi|462396804|gb|EMJ02603.1| hypothetical protein PRUPE_ppa012249mg [Prunus persica] Length = 178 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +2 Query: 278 AFVVRAMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 +F V+AM +SFGSRLEE+VKKTV ENPVVV+SKTWCSYS Sbjct: 59 SFSVKAMASSFGSRLEESVKKTVDENPVVVYSKTWCSYS 97 >gb|EXB46054.1| Glutaredoxin-C5 [Morus notabilis] Length = 176 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/52 (63%), Positives = 42/52 (80%), Gaps = 5/52 (9%) Frame = +2 Query: 254 STYFGRRGA-----FVVRAMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 +++FG G+ V+AM++SFGSRLEE VKKTV+ENPVVV+SKTWCSYS Sbjct: 45 TSFFGVHGSRRCRPISVQAMSSSFGSRLEETVKKTVTENPVVVYSKTWCSYS 96 >ref|XP_007050087.1| Glutaredoxin family protein isoform 3 [Theobroma cacao] gi|508702348|gb|EOX94244.1| Glutaredoxin family protein isoform 3 [Theobroma cacao] Length = 166 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 287 VRAMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 VR M +SFGSRLEENVKKTV++NPVVV+SKTWCSYS Sbjct: 59 VRGMASSFGSRLEENVKKTVADNPVVVYSKTWCSYS 94 >ref|XP_007050085.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] gi|590715051|ref|XP_007050086.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] gi|508702346|gb|EOX94242.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] gi|508702347|gb|EOX94243.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] Length = 175 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 287 VRAMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 VR M +SFGSRLEENVKKTV++NPVVV+SKTWCSYS Sbjct: 59 VRGMASSFGSRLEENVKKTVADNPVVVYSKTWCSYS 94 >gb|EXB64479.1| Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase [Morus notabilis] Length = 622 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 5/50 (10%) Frame = +2 Query: 254 STYFGRRGA-----FVVRAMTASFGSRLEENVKKTVSENPVVVFSKTWCS 388 +++FG G+ V+AM++SFGSRLEE VKKTV+ENPVVV+SKTWCS Sbjct: 573 TSFFGVHGSRRCRPISVQAMSSSFGSRLEETVKKTVTENPVVVYSKTWCS 622 >ref|XP_006854323.1| hypothetical protein AMTR_s00039p00123020, partial [Amborella trichopoda] gi|548857999|gb|ERN15790.1| hypothetical protein AMTR_s00039p00123020, partial [Amborella trichopoda] Length = 91 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 293 AMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 AM ASFGSRLEE+VK+TV ENP+V++SKTWCSYS Sbjct: 2 AMAASFGSRLEESVKRTVVENPIVIYSKTWCSYS 35 >ref|XP_006408941.1| hypothetical protein EUTSA_v10002105mg [Eutrema salsugineum] gi|557110097|gb|ESQ50394.1| hypothetical protein EUTSA_v10002105mg [Eutrema salsugineum] Length = 178 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/59 (55%), Positives = 42/59 (71%), Gaps = 2/59 (3%) Frame = +2 Query: 224 RRRIDDNDLRSTYFGRRGAFVVRAMTAS--FGSRLEENVKKTVSENPVVVFSKTWCSYS 394 R + LR + G+ VVRAM++S FGS LEE+VK TV+ENPVVV+SK+WCSYS Sbjct: 39 RNCLKPTPLRLASWPPHGSSVVRAMSSSSSFGSTLEESVKSTVAENPVVVYSKSWCSYS 97 >ref|XP_002521163.1| glutaredoxin, grx, putative [Ricinus communis] gi|223539732|gb|EEF41314.1| glutaredoxin, grx, putative [Ricinus communis] Length = 158 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 287 VRAMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 VRAM ASFGSRLEE VK+TVSE+PVVV+SKTWCSYS Sbjct: 69 VRAM-ASFGSRLEEGVKRTVSESPVVVYSKTWCSYS 103 >emb|CBI37229.3| unnamed protein product [Vitis vinifera] Length = 114 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 296 MTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 M +SFGSRLEE VKKTV ENPVVV+SKTWCSYS Sbjct: 1 MASSFGSRLEETVKKTVDENPVVVYSKTWCSYS 33 >ref|XP_003542446.2| PREDICTED: glutaredoxin-C5, chloroplastic isoform X1 [Glycine max] Length = 177 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +2 Query: 284 VVRAMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 VVRA T+SFGSRLE+ +KKTV+ENPVV++SKTWCSYS Sbjct: 61 VVRA-TSSFGSRLEDTIKKTVAENPVVLYSKTWCSYS 96 >ref|XP_004290010.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 171 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 269 RRGAFVVRAMTASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 RR V ++SFGSRLEE+VKKTV +NPVVV+SKTWCSYS Sbjct: 49 RRPISVKSMSSSSFGSRLEESVKKTVDDNPVVVYSKTWCSYS 90 >pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione gi|224036433|pdb|3FZA|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione And Beta-Mercaptoethanol Length = 112 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 302 ASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 ASFGSRLE+ VKKTV+ENPVVV+SKTWCSYS Sbjct: 1 ASFGSRLEDAVKKTVAENPVVVYSKTWCSYS 31 >ref|XP_002303098.2| glutaredoxin family protein [Populus trichocarpa] gi|550345808|gb|EEE82371.2| glutaredoxin family protein [Populus trichocarpa] Length = 183 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 299 TASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 ++SFGSRLE+ VKKTV+ENPVVV+SKTWCSYS Sbjct: 73 SSSFGSRLEDAVKKTVAENPVVVYSKTWCSYS 104 >gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremuloides] Length = 185 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 299 TASFGSRLEENVKKTVSENPVVVFSKTWCSYS 394 ++SFGSRLE+ VKKTV+ENPVVV+SKTWCSYS Sbjct: 73 SSSFGSRLEDAVKKTVAENPVVVYSKTWCSYS 104