BLASTX nr result
ID: Cocculus23_contig00011823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00011823 (258 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29848.3| unnamed protein product [Vitis vinifera] 55 1e-05 emb|CAN69089.1| hypothetical protein VITISV_009157 [Vitis vinifera] 55 1e-05 >emb|CBI29848.3| unnamed protein product [Vitis vinifera] Length = 426 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -3 Query: 226 TFEELPSSIGNLKLLRYLCLI-SKSIKVLPQSVCQLYHLESL 104 +FE LPSSIGN+K LRYL L+ +K IK LP S+C+LYHL++L Sbjct: 305 SFEVLPSSIGNMKHLRYLSLLRNKRIKKLPASICKLYHLQTL 346 >emb|CAN69089.1| hypothetical protein VITISV_009157 [Vitis vinifera] Length = 815 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -3 Query: 226 TFEELPSSIGNLKLLRYLCLI-SKSIKVLPQSVCQLYHLESL 104 +FE LPSSIGN+K LRYL L+ +K IK LP S+C+LYHL++L Sbjct: 546 SFEVLPSSIGNMKHLRYLSLLRNKRIKKLPASICKLYHLQTL 587