BLASTX nr result
ID: Cocculus23_contig00011562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00011562 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004133997.1| PREDICTED: probable calcium-binding protein ... 57 3e-06 gb|AFW70732.1| hypothetical protein ZEAMMB73_407060, partial [Ze... 57 3e-06 ref|NP_001131792.1| calcium ion binding protein [Zea mays] gi|19... 57 3e-06 ref|XP_006857595.1| hypothetical protein AMTR_s00061p00095500 [A... 57 4e-06 ref|XP_006370792.1| hypothetical protein POPTR_0001s47510g [Popu... 56 5e-06 ref|XP_004951561.1| PREDICTED: probable calcium-binding protein ... 55 8e-06 ref|XP_002451725.1| hypothetical protein SORBIDRAFT_04g006670 [S... 55 8e-06 >ref|XP_004133997.1| PREDICTED: probable calcium-binding protein CML22-like [Cucumis sativus] gi|449487538|ref|XP_004157676.1| PREDICTED: probable calcium-binding protein CML22-like [Cucumis sativus] Length = 227 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -3 Query: 286 ISVAS*KTRRRQRRVDLKQEEMDWTNSGKISFKEFVFTFTNWVGIDGDDD 137 ++ AS R R + +EMDW NSGK++F+EF+F F NWVG+D DDD Sbjct: 174 LNEASPYERSPARITKTRFKEMDWNNSGKVNFREFLFGFINWVGVDTDDD 223 >gb|AFW70732.1| hypothetical protein ZEAMMB73_407060, partial [Zea mays] Length = 98 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = -3 Query: 259 RRQRRVDLKQ-EEMDWTNSGKISFKEFVFTFTNWVGIDGDDDQDHFK 122 R R+ +++ EEMDW +G ++FKEF+F FT WVGID +DD D K Sbjct: 50 RSSGRIGMRRFEEMDWDKNGTVTFKEFLFAFTRWVGIDNEDDDDEDK 96 >ref|NP_001131792.1| calcium ion binding protein [Zea mays] gi|194692548|gb|ACF80358.1| unknown [Zea mays] gi|195638276|gb|ACG38606.1| calcium ion binding protein [Zea mays] gi|413936180|gb|AFW70731.1| calcium ion binding protein [Zea mays] Length = 227 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = -3 Query: 259 RRQRRVDLKQ-EEMDWTNSGKISFKEFVFTFTNWVGIDGDDDQDHFK 122 R R+ +++ EEMDW +G ++FKEF+F FT WVGID +DD D K Sbjct: 179 RSSGRIGMRRFEEMDWDKNGTVTFKEFLFAFTRWVGIDNEDDDDEDK 225 >ref|XP_006857595.1| hypothetical protein AMTR_s00061p00095500 [Amborella trichopoda] gi|548861691|gb|ERN19062.1| hypothetical protein AMTR_s00061p00095500 [Amborella trichopoda] Length = 226 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -3 Query: 259 RRQRRVDLKQ-EEMDWTNSGKISFKEFVFTFTNWVGIDGDDDQD 131 R R+ +++ EEMDW +G +SFKEF+F FT+WVGID D+++D Sbjct: 181 RSSGRIAMRRFEEMDWDKNGMVSFKEFLFAFTHWVGIDADEEED 224 >ref|XP_006370792.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa] gi|550350091|gb|ERP67361.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa] Length = 224 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -3 Query: 259 RRQRRVDLKQ-EEMDWTNSGKISFKEFVFTFTNWVGIDGDDDQD 131 R R+ +K+ EEMDW +G ++FKEF+F FTNWVGID ++D++ Sbjct: 180 RSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTNWVGIDDNEDEE 223 >ref|XP_004951561.1| PREDICTED: probable calcium-binding protein CML21-like [Setaria italica] Length = 226 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 259 RRQRRVDLKQ-EEMDWTNSGKISFKEFVFTFTNWVGIDGDDDQD 131 R R+ +K+ EEMDW +G ++FKEF+F FT WVGID +DD + Sbjct: 179 RSSGRIGVKRFEEMDWDKNGTVTFKEFLFAFTRWVGIDNEDDDE 222 >ref|XP_002451725.1| hypothetical protein SORBIDRAFT_04g006670 [Sorghum bicolor] gi|241931556|gb|EES04701.1| hypothetical protein SORBIDRAFT_04g006670 [Sorghum bicolor] Length = 228 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 259 RRQRRVDLKQ-EEMDWTNSGKISFKEFVFTFTNWVGIDGDDDQD 131 R R+ +K+ EEMDW +G ++FKEF+F FT WVGID +DD + Sbjct: 179 RSSGRIGVKRFEEMDWDKNGTVTFKEFLFAFTRWVGIDNEDDDE 222