BLASTX nr result
ID: Cocculus23_contig00011407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00011407 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836171.1| hypothetical protein AMTR_s00101p00054450 [A... 57 3e-06 >ref|XP_006836171.1| hypothetical protein AMTR_s00101p00054450 [Amborella trichopoda] gi|548838671|gb|ERM99024.1| hypothetical protein AMTR_s00101p00054450 [Amborella trichopoda] Length = 179 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +2 Query: 107 STQEPSETRSEKILESEQWPILQSWNVPWDWKITLFVMMPYLM 235 S++E S+K + WPILQ W+VPWDWK+ +FVM+PY+M Sbjct: 64 SSEESDVDCSDKPTKINLWPILQPWDVPWDWKVAVFVMLPYVM 106