BLASTX nr result
ID: Cocculus23_contig00011325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00011325 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlise... 114 1e-23 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 74 3e-11 >gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlisea aurea] Length = 84 Score = 114 bits (286), Expect = 1e-23 Identities = 53/56 (94%), Positives = 53/56 (94%) Frame = -2 Query: 327 GWANLWCTGCYANSSAGQLSWYGRTAAPREILLYTSSRTRFLNRTSIGERCKHREV 160 GWANLW TGCYANSSAG LSWYGRTAA REILLYTSSRTRFLNRTSIGERCKHREV Sbjct: 29 GWANLWSTGCYANSSAGLLSWYGRTAAQREILLYTSSRTRFLNRTSIGERCKHREV 84 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 135 FRLVRDR*TPRGAYTSRLSKFCSKTSYENLYREGFP 242 FRLVRDR TPRGAYTSRLSKFCSKTS+ENLYREGFP Sbjct: 359 FRLVRDRFTPRGAYTSRLSKFCSKTSFENLYREGFP 394