BLASTX nr result
ID: Cocculus23_contig00010581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00010581 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC24564.1| trypsin inhibitor [Pisum sativum] 76 6e-12 sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase... 75 7e-12 emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] 75 7e-12 emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] 75 9e-12 sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-ind... 74 2e-11 emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] 74 2e-11 emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] 74 2e-11 emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|... 73 4e-11 emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] 73 4e-11 emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp... 73 4e-11 emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp... 73 4e-11 emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|6... 73 4e-11 pdb|1PBI|A Chain A, Crystal Structure Of A Bowman-Birk Inhibitor... 72 6e-11 ref|XP_003623932.1| Trypsin inhibitor [Medicago truncatula] gi|3... 72 6e-11 gb|ADV40042.1| BBI inhibitor [Lathyrus sativus] 72 8e-11 gb|ADV40041.1| BBI inhibitor [Lathyrus sativus] 72 8e-11 gb|ADV40040.1| BBI inhibitor [Lathyrus sativus] 72 8e-11 gb|ADV40029.1| BBI inhibitor [Lathyrus sativus] gi|318086905|gb|... 72 8e-11 gb|AFK40073.1| unknown [Lotus japonicus] 72 8e-11 emb|CAC24565.1| putative trypsin inhibitor [Pisum sativum] 72 8e-11 >emb|CAC24564.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 75.9 bits (185), Expect = 6e-12 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CC++ +C S PP+CRC D+ E C CK C CT+S PPQC+C D+T + KC Sbjct: 50 CCDSCLCTRSIPPRCRCNDIGETCHSACKTCICTRSLPPQCRCIDITDFCYEKC 103 >sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase inhibitor; Short=LaBBI Length = 63 Score = 75.5 bits (184), Expect = 7e-12 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +1 Query: 10 PCCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 PCC++ +C S PP+CRC D+ E C CK C CT+S PPQC+C D+T + C Sbjct: 6 PCCDSCLCTRSIPPQCRCTDIGETCHSACKSCICTRSFPPQCRCSDITHFCYKPC 60 >emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] Length = 104 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN+ C S PPKCRC D+ E C CK C CT+S PPQC+C DVT + C Sbjct: 50 CCNSCPCTRSIPPKCRCTDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] Length = 104 Score = 75.1 bits (183), Expect = 9e-12 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN+ C S PPKC C D+ E C CK C CT+S PPQC+C DVT + KC Sbjct: 50 CCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKKC 103 >sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-induced trypsin inhibitor Length = 58 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/54 (53%), Positives = 33/54 (61%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN C S PP+CRC D+ E C CK C CTKS PPQC C D+T + KC Sbjct: 4 CCNFCPCTRSIPPQCRCTDIGETCHSACKTCLCTKSIPPQCHCADITNFCYPKC 57 >emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN C S PP+CRC D+ E C CK C CT+S PPQC+C D+T + KC Sbjct: 59 CCNFCPCTKSIPPQCRCSDIGETCHSACKSCICTRSYPPQCRCTDITNFCYPKC 112 >emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN C S PP+CRC D+ E C CK C CT+S PPQC+C D+T + KC Sbjct: 59 CCNFCPCTRSIPPQCRCTDIGETCHSACKSCLCTRSIPPQCRCTDITNFCYPKC 112 >emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|66840748|emb|CAH04449.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 73.2 bits (178), Expect = 4e-11 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN+ C S PPKC C D+ E C CK C CT+S PPQC+C DVT + C Sbjct: 50 CCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 73.2 bits (178), Expect = 4e-11 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN+ C S PPKC C D+ E C CK C CT+S PPQC+C DVT + C Sbjct: 50 CCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 73.2 bits (178), Expect = 4e-11 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN+ C S PPKC C D+ E C CK C CT+S PPQC+C DVT + C Sbjct: 50 CCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] gi|66840754|emb|CAH04452.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] Length = 104 Score = 73.2 bits (178), Expect = 4e-11 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN+ C S PPKC C D+ E C CK C CT+S PPQC+C DVT + C Sbjct: 50 CCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|66840740|emb|CAH04445.1| putative trypsin inhibitor [Lens culinaris] gi|66840744|emb|CAH04447.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 73.2 bits (178), Expect = 4e-11 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CCN+ C S PPKC C D+ E C CK C CT+S PPQC+C DVT + C Sbjct: 50 CCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >pdb|1PBI|A Chain A, Crystal Structure Of A Bowman-Birk Inhibitor From Pea Seeds gi|4389008|pdb|1PBI|B Chain B, Crystal Structure Of A Bowman-Birk Inhibitor From Pea Seeds Length = 72 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/59 (47%), Positives = 33/59 (55%) Frame = +1 Query: 4 KPPCCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKCPN 180 K CC+ +C S PP CRC DV E C C C C SNPP+CQCFD + +C N Sbjct: 5 KSACCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFDTQKFCYKQCHN 63 >ref|XP_003623932.1| Trypsin inhibitor [Medicago truncatula] gi|355498947|gb|AES80150.1| Trypsin inhibitor [Medicago truncatula] Length = 86 Score = 72.4 bits (176), Expect = 6e-11 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKC 174 CC++ C S PP+C C D+ E C CK C CTKS PPQC C D+T + KC Sbjct: 32 CCDSCPCTKSIPPQCHCTDIGETCHSACKSCLCTKSIPPQCHCADITDFCYPKC 85 >gb|ADV40042.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/59 (47%), Positives = 33/59 (55%) Frame = +1 Query: 4 KPPCCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKCPN 180 K CC+ +C S PP CRC D+ E C C C CT S PPQC+CFD T + C N Sbjct: 47 KSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRCFDTTKFCYKACHN 105 >gb|ADV40041.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/59 (47%), Positives = 33/59 (55%) Frame = +1 Query: 4 KPPCCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKCPN 180 K CC+ +C S PP CRC D+ E C C C CT S PPQC+CFD T + C N Sbjct: 47 KSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRCFDTTKFCYKACHN 105 >gb|ADV40040.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/59 (47%), Positives = 33/59 (55%) Frame = +1 Query: 4 KPPCCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKCPN 180 K CC+ +C S PP CRC D+ E C C C CT S PPQC+CFD T + C N Sbjct: 47 KSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRCFDTTKFCYKACHN 105 >gb|ADV40029.1| BBI inhibitor [Lathyrus sativus] gi|318086905|gb|ADV40053.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/59 (47%), Positives = 33/59 (55%) Frame = +1 Query: 4 KPPCCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPYNLLKCPN 180 K CC+ +C S PP CRC D+ E C C C CT S PPQC+CFD T + C N Sbjct: 47 KSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRCFDTTKFCYKACHN 105 >gb|AFK40073.1| unknown [Lotus japonicus] Length = 119 Score = 72.0 bits (175), Expect = 8e-11 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPY 159 CCN+ C S PP+CRC D+ E C CK C CT+S PPQC+C D+T + Sbjct: 59 CCNSCPCTRSIPPQCRCTDIGETCHSACKACICTRSIPPQCRCLDITNF 107 >emb|CAC24565.1| putative trypsin inhibitor [Pisum sativum] Length = 133 Score = 72.0 bits (175), Expect = 8e-11 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = +1 Query: 13 CCNAGICALSCPPKCRCYDVDEVCRGGCKDCRCTKSNPPQCQCFDVTPY 159 CC++ +C S PP+CRC D E C CK C CT+S PPQC+C D+T + Sbjct: 50 CCDSCLCTKSIPPRCRCNDTGETCHSACKTCICTRSLPPQCRCIDITDF 98