BLASTX nr result
ID: Cocculus23_contig00008144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00008144 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007132398.1| hypothetical protein PHAVU_011G091400g [Phas... 62 6e-08 ref|XP_003539179.1| PREDICTED: dehydration-responsive element-bi... 62 6e-08 dbj|BAF36841.1| CRT-binding factor [Lolium perenne] 62 1e-07 gb|AFP33244.1| dehydration responsive element binding protein 1A... 60 3e-07 gb|AFP33243.1| dehydration responsive element binding protein 1A... 60 3e-07 gb|AFP33239.1| dehydration responsive element binding protein 1A... 60 3e-07 ref|XP_002462690.1| hypothetical protein SORBIDRAFT_02g030310 [S... 60 3e-07 ref|NP_001152672.1| sbCBF6 [Zea mays] gi|195658781|gb|ACG48858.1... 60 3e-07 ref|XP_002457016.1| hypothetical protein SORBIDRAFT_03g047170 [S... 60 4e-07 dbj|BAF36842.1| CRT-binding factor [Lolium perenne] 60 4e-07 gb|ABK32848.1| C-repeat/DRE-binding factor 3 [Lolium perenne] 60 4e-07 gb|ABK32847.1| C-repeat/DRE-binding factor 3 [Lolium perenne] 60 4e-07 ref|XP_004957402.1| PREDICTED: dehydration-responsive element-bi... 59 5e-07 gb|EMT33162.1| Dehydration-responsive element-binding protein 1A... 59 5e-07 ref|XP_003540786.1| PREDICTED: dehydration-responsive element-bi... 59 5e-07 gb|ABU55662.1| CBF1-like protein [Ampelopsis glandulosa var. bre... 59 5e-07 gb|AHG97393.1| C-repeat-binding transcription factor 3 [Vitis vi... 59 7e-07 ref|XP_002267961.1| PREDICTED: dehydration-responsive element-bi... 59 7e-07 gb|AAR28675.1| CBF-like transcription factor [Vitis riparia] 59 7e-07 ref|XP_003576749.1| PREDICTED: dehydration-responsive element-bi... 59 7e-07 >ref|XP_007132398.1| hypothetical protein PHAVU_011G091400g [Phaseolus vulgaris] gi|561005398|gb|ESW04392.1| hypothetical protein PHAVU_011G091400g [Phaseolus vulgaris] Length = 222 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 PS KR+AGRKKFRETRHPVYRGVRQR NG KWV Sbjct: 28 PSHKRKAGRKKFRETRHPVYRGVRQR-NGNKWV 59 >ref|XP_003539179.1| PREDICTED: dehydration-responsive element-binding protein 1F-like [Glycine max] Length = 236 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 PS KR+AGRKKFRETRHPVYRGVRQR NG KWV Sbjct: 46 PSHKRKAGRKKFRETRHPVYRGVRQR-NGNKWV 77 >dbj|BAF36841.1| CRT-binding factor [Lolium perenne] Length = 252 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 116 TAALQPSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 TA PS KR AGR KF+ETRHPVYRGVR+RG+ G+WV Sbjct: 23 TAPWSPSPKRPAGRTKFKETRHPVYRGVRRRGSAGRWV 60 >gb|AFP33244.1| dehydration responsive element binding protein 1A [Sorghum halepense] Length = 280 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 104 QPSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 QP +KR AGR KFRETRHPVYRGVR+RG G+WV Sbjct: 46 QPPKKRPAGRTKFRETRHPVYRGVRRRGAAGRWV 79 >gb|AFP33243.1| dehydration responsive element binding protein 1A [Sorghum bicolor] Length = 278 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 104 QPSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 QP +KR AGR KFRETRHPVYRGVR+RG G+WV Sbjct: 46 QPPKKRPAGRTKFRETRHPVYRGVRRRGAAGRWV 79 >gb|AFP33239.1| dehydration responsive element binding protein 1A [Sorghum bicolor] gi|399163420|gb|AFP33240.1| dehydration responsive element binding protein 1A [Sorghum bicolor] gi|399163422|gb|AFP33241.1| dehydration responsive element binding protein 1A [Sorghum bicolor] gi|399163424|gb|AFP33242.1| dehydration responsive element binding protein 1A [Sorghum bicolor] Length = 278 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 104 QPSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 QP +KR AGR KFRETRHPVYRGVR+RG G+WV Sbjct: 46 QPPKKRPAGRTKFRETRHPVYRGVRRRGAAGRWV 79 >ref|XP_002462690.1| hypothetical protein SORBIDRAFT_02g030310 [Sorghum bicolor] gi|241926067|gb|EER99211.1| hypothetical protein SORBIDRAFT_02g030310 [Sorghum bicolor] Length = 275 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 104 QPSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 QP +KR AGR KFRETRHPVYRGVR+RG G+WV Sbjct: 46 QPPKKRPAGRTKFRETRHPVYRGVRRRGAAGRWV 79 >ref|NP_001152672.1| sbCBF6 [Zea mays] gi|195658781|gb|ACG48858.1| sbCBF6 [Zea mays] gi|414590014|tpg|DAA40585.1| TPA: putative AP2/EREBP transcription factor superfamily protein [Zea mays] Length = 230 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 119 ETAALQPSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 +TA P +KR AGR KFRETRHPV+RGVR+RG G+WV Sbjct: 31 QTAWASPPKKRPAGRTKFRETRHPVFRGVRRRGRAGRWV 69 >ref|XP_002457016.1| hypothetical protein SORBIDRAFT_03g047170 [Sorghum bicolor] gi|241928991|gb|EES02136.1| hypothetical protein SORBIDRAFT_03g047170 [Sorghum bicolor] Length = 242 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 92 KRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 KRRAGRKKFRETRHPVYRGVR RG G +WV Sbjct: 30 KRRAGRKKFRETRHPVYRGVRARGGGTRWV 59 >dbj|BAF36842.1| CRT-binding factor [Lolium perenne] Length = 247 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 116 TAALQPSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 TA P KR AGR KF+ETRHPVYRGVR+RG+ G+WV Sbjct: 23 TAPWSPPPKRPAGRTKFKETRHPVYRGVRRRGSAGRWV 60 >gb|ABK32848.1| C-repeat/DRE-binding factor 3 [Lolium perenne] Length = 237 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 P KR AGR KFRETRHPVYRGVR+RGN G+WV Sbjct: 39 PWTKRPAGRTKFRETRHPVYRGVRRRGNAGRWV 71 >gb|ABK32847.1| C-repeat/DRE-binding factor 3 [Lolium perenne] Length = 237 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 P KR AGR KFRETRHPVYRGVR+RGN G+WV Sbjct: 39 PWTKRPAGRTKFRETRHPVYRGVRRRGNAGRWV 71 >ref|XP_004957402.1| PREDICTED: dehydration-responsive element-binding protein 1H-like [Setaria italica] Length = 256 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 104 QPSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 QP++KR AGR KFRETRHPV+RGVR+RG G+WV Sbjct: 39 QPAKKRPAGRTKFRETRHPVFRGVRRRGAAGRWV 72 >gb|EMT33162.1| Dehydration-responsive element-binding protein 1A [Aegilops tauschii] Length = 244 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 92 KRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 KR AGR KFRETRHPV+RGVR+RGNGG+WV Sbjct: 29 KRPAGRTKFRETRHPVFRGVRRRGNGGRWV 58 >ref|XP_003540786.1| PREDICTED: dehydration-responsive element-binding protein 1F-like [Glycine max] Length = 229 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 PS KR+AGRKKFRETRHPVYRGVRQR N KWV Sbjct: 47 PSHKRKAGRKKFRETRHPVYRGVRQR-NRNKWV 78 >gb|ABU55662.1| CBF1-like protein [Ampelopsis glandulosa var. brevipedunculata] Length = 206 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 98 SQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 S KR+AGRKKFRETRHP+YRGVRQR NG KWV Sbjct: 16 SHKRKAGRKKFRETRHPIYRGVRQR-NGNKWV 46 >gb|AHG97393.1| C-repeat-binding transcription factor 3 [Vitis vinifera] Length = 239 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 P KR+AGRKKFRETRHPVYRGVRQR NG +WV Sbjct: 27 PVHKRKAGRKKFRETRHPVYRGVRQR-NGNRWV 58 >ref|XP_002267961.1| PREDICTED: dehydration-responsive element-binding protein 1D [Vitis vinifera] gi|39578548|gb|AAR28676.1| CBF-like transcription factor [Vitis vinifera] Length = 239 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 P KR+AGRKKFRETRHPVYRGVRQR NG +WV Sbjct: 27 PVHKRKAGRKKFRETRHPVYRGVRQR-NGNRWV 58 >gb|AAR28675.1| CBF-like transcription factor [Vitis riparia] Length = 239 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 P KR+AGRKKFRETRHPVYRGVRQR NG +WV Sbjct: 27 PVHKRKAGRKKFRETRHPVYRGVRQR-NGNRWV 58 >ref|XP_003576749.1| PREDICTED: dehydration-responsive element-binding protein 1A-like [Brachypodium distachyon] gi|380702852|gb|AFD96409.1| CBF3 [Brachypodium distachyon] Length = 250 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 101 PSQKRRAGRKKFRETRHPVYRGVRQRGNGGKWV 3 P KR AGR KF+ETRHPVYRGVR RGN G+WV Sbjct: 29 PPPKRPAGRTKFKETRHPVYRGVRHRGNAGRWV 61