BLASTX nr result
ID: Cocculus23_contig00006945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00006945 (527 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265373.1| PREDICTED: probable alpha-ketoglutarate-depe... 59 7e-07 ref|XP_003619546.1| Alkylated DNA repair protein alkB-like prote... 57 3e-06 ref|XP_004512614.1| PREDICTED: alpha-ketoglutarate-dependent dio... 55 8e-06 ref|XP_004294928.1| PREDICTED: alpha-ketoglutarate-dependent dio... 55 8e-06 >ref|XP_002265373.1| PREDICTED: probable alpha-ketoglutarate-dependent dioxygenase ABH6 [Vitis vinifera] gi|296081091|emb|CBI18285.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/59 (54%), Positives = 43/59 (72%), Gaps = 7/59 (11%) Frame = +3 Query: 3 VVNTFES-QKHQ------GQEDTVEVECTEQIKSIERTSTRVSLTCRLVLKVHKSLFKF 158 VVN E+ ++H+ G E VEV +++SI+RT+TR+SLTCRLVLKVHK+LFKF Sbjct: 204 VVNDIEALEQHRLDPLFSGSEKAVEVMRNGELRSIQRTTTRISLTCRLVLKVHKNLFKF 262 >ref|XP_003619546.1| Alkylated DNA repair protein alkB-like protein [Medicago truncatula] gi|355494561|gb|AES75764.1| Alkylated DNA repair protein alkB-like protein [Medicago truncatula] Length = 266 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +3 Query: 18 ESQKHQ-GQEDTVEVECTEQIKSIERTSTRVSLTCRLVLKVHKSLFKF 158 ES KH G ED +E E+ K+I RTS R+SLTCRLV KVHK+LF+F Sbjct: 219 ESDKHLFGSEDALEAIGKEEYKNISRTSNRISLTCRLVPKVHKNLFRF 266 >ref|XP_004512614.1| PREDICTED: alpha-ketoglutarate-dependent dioxygenase alkB homolog 6-like isoform X1 [Cicer arietinum] gi|502162784|ref|XP_004512615.1| PREDICTED: alpha-ketoglutarate-dependent dioxygenase alkB homolog 6-like isoform X2 [Cicer arietinum] gi|502162787|ref|XP_004512616.1| PREDICTED: alpha-ketoglutarate-dependent dioxygenase alkB homolog 6-like isoform X3 [Cicer arietinum] Length = 259 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +3 Query: 18 ESQKHQ-GQEDTVEVECTEQIKSIERTSTRVSLTCRLVLKVHKSLFKF 158 ES +H G ED +E E+ K+I RTS R+SLTCRLV KVHK+LF+F Sbjct: 212 ESDRHLFGTEDALETVGKEEYKNISRTSNRISLTCRLVPKVHKNLFRF 259 >ref|XP_004294928.1| PREDICTED: alpha-ketoglutarate-dependent dioxygenase alkB homolog 6-like [Fragaria vesca subsp. vesca] Length = 301 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 42 EDTVEVECTEQIKSIERTSTRVSLTCRLVLKVHKSLFKF 158 + TVE T +KSI RT+TRVSLTCRLVLKVHK+LF+F Sbjct: 263 DGTVETLNTGDLKSIHRTTTRVSLTCRLVLKVHKNLFRF 301