BLASTX nr result
ID: Cocculus23_contig00006893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00006893 (971 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525265.1| transcription cofactor, putative [Ricinus co... 60 2e-06 ref|XP_007205343.1| hypothetical protein PRUPE_ppa007060mg [Prun... 59 2e-06 >ref|XP_002525265.1| transcription cofactor, putative [Ricinus communis] gi|223535423|gb|EEF37093.1| transcription cofactor, putative [Ricinus communis] Length = 347 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +2 Query: 2 RNFKEKLKRQNKKDEMRWKILVKYIMRAKRISATPFSSLAIAC 130 +NFK ++KRQ+KKDE++W+ILVK I+R KRI +PF + AI+C Sbjct: 303 KNFKARIKRQSKKDEIKWRILVKKIIRTKRIGGSPFFTSAISC 345 >ref|XP_007205343.1| hypothetical protein PRUPE_ppa007060mg [Prunus persica] gi|462400985|gb|EMJ06542.1| hypothetical protein PRUPE_ppa007060mg [Prunus persica] Length = 384 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +2 Query: 2 RNFKEKLKRQNKKDEMRWKILVKYIMRAKRISATPFSSLA 121 RNFKE++K+Q+KKDE+RWK+LVK I+R KRI+ PF S A Sbjct: 338 RNFKERIKKQSKKDEIRWKMLVKKILRTKRIAGAPFISSA 377