BLASTX nr result
ID: Cocculus23_contig00006672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00006672 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268453.1| PREDICTED: uncharacterized protein LOC100264... 58 1e-06 >ref|XP_002268453.1| PREDICTED: uncharacterized protein LOC100264843 [Vitis vinifera] gi|297740352|emb|CBI30534.3| unnamed protein product [Vitis vinifera] Length = 255 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/66 (46%), Positives = 43/66 (65%) Frame = -1 Query: 254 MNEMNEDPSEICSFHVNEVIREGTVDLNKKRKLLDELLGLPPPKYKFRDRSSGSVQLFPF 75 M+E N++PSE+ S HV + + +DL KKRKL ELL LP PK+K RS S ++P Sbjct: 1 MDETNKNPSELHSSHVCKELNTNIMDLKKKRKLQAELLDLPLPKHKCCGRSFSSQIVYPL 60 Query: 74 VEDSEM 57 ED+E+ Sbjct: 61 DEDTEI 66