BLASTX nr result
ID: Cocculus23_contig00006577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00006577 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519761.1| Flavonol synthase/flavanone 3-hydroxylase, p... 59 5e-07 ref|XP_007149499.1| hypothetical protein PHAVU_005G075500g [Phas... 55 8e-06 >ref|XP_002519761.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus communis] gi|223541178|gb|EEF42734.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus communis] Length = 360 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -3 Query: 170 MENAQAPVTLGTSLLVPSVQEMAKKPLSTVPERYVRNDEQEPHLVMKSDSTLSIPI 3 ME+ +TLG+SL VPSVQE+A K L+TVP RYVR+D+ P + S S+ +P+ Sbjct: 1 MESKVTALTLGSSLPVPSVQELANKSLATVPTRYVRSDQDPPFIPTSSSSSSQVPV 56 >ref|XP_007149499.1| hypothetical protein PHAVU_005G075500g [Phaseolus vulgaris] gi|561022763|gb|ESW21493.1| hypothetical protein PHAVU_005G075500g [Phaseolus vulgaris] Length = 311 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = -3 Query: 146 TLGTSLLVPSVQEMAKKPLSTVPERYVRNDEQEPHLVMKSDSTLSIPI 3 T GTSLLVPSVQE+AK+ LSTVP+RY++ QE +++ L IP+ Sbjct: 7 TSGTSLLVPSVQELAKQNLSTVPQRYIQPQHQEQMVLISQQPNLEIPV 54