BLASTX nr result
ID: Cocculus23_contig00006235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00006235 (843 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524976.1| Multidrug resistance protein mdtG, putative ... 60 1e-06 ref|XP_006832881.1| hypothetical protein AMTR_s00095p00099600, p... 58 4e-06 >ref|XP_002524976.1| Multidrug resistance protein mdtG, putative [Ricinus communis] gi|223535720|gb|EEF37383.1| Multidrug resistance protein mdtG, putative [Ricinus communis] Length = 384 Score = 60.1 bits (144), Expect = 1e-06 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = -2 Query: 257 MAENREPLLKKVYYKDCPGCKIDQHKETRQVIPYNEFTYVSVVTLCNGRTVCGI 96 M+ + EPLLKK YY++CPGCK+DQ KE R +P EF + +V LC + + Sbjct: 1 MSSSTEPLLKKNYYENCPGCKVDQIKELRTGLPIKEFVSIWIVVLCTALPISSL 54 >ref|XP_006832881.1| hypothetical protein AMTR_s00095p00099600, partial [Amborella trichopoda] gi|548837381|gb|ERM98159.1| hypothetical protein AMTR_s00095p00099600, partial [Amborella trichopoda] Length = 442 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -2 Query: 257 MAENREPLLK-KVYYKDCPGCKIDQHKETRQVIPYNEFTYVSVVTLCNGRTVCGI 96 MAEN E LLK K YY++CPGCK+DQ KE + P E ++++V LCN + + Sbjct: 1 MAENEEALLKTKDYYENCPGCKVDQMKEINRGFPLKECFFIAIVVLCNALPISSL 55