BLASTX nr result
ID: Cocculus23_contig00006040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00006040 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33382.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_002284533.1| PREDICTED: eukaryotic translation initiation... 68 1e-09 gb|EYU18691.1| hypothetical protein MIMGU_mgv1a006587mg [Mimulus... 65 1e-08 ref|XP_006491490.1| PREDICTED: eukaryotic translation initiation... 64 2e-08 ref|XP_004303635.1| PREDICTED: eukaryotic translation initiation... 64 3e-08 gb|AFK46442.1| unknown [Medicago truncatula] 63 4e-08 gb|ACJ84594.1| unknown [Medicago truncatula] 63 4e-08 ref|XP_002532670.1| eukaryotic translation initiation factor 3 s... 63 5e-08 ref|XP_007202066.1| hypothetical protein PRUPE_ppa005923mg [Prun... 62 8e-08 ref|XP_006421164.1| hypothetical protein CICLE_v10004983mg [Citr... 61 2e-07 ref|XP_006837958.1| hypothetical protein AMTR_s00102p00062980 [A... 60 2e-07 gb|EYU20768.1| hypothetical protein MIMGU_mgv1a006585mg [Mimulus... 60 3e-07 ref|XP_007145575.1| hypothetical protein PHAVU_007G250100g [Phas... 60 4e-07 ref|XP_003519090.1| PREDICTED: eukaryotic translation initiation... 60 4e-07 ref|XP_004516371.1| PREDICTED: eukaryotic translation initiation... 59 5e-07 ref|XP_003535892.1| PREDICTED: eukaryotic translation initiation... 59 5e-07 gb|ACU17653.1| unknown [Glycine max] 59 5e-07 ref|XP_002308015.1| eukaryotic translation initiation factor 3E ... 59 7e-07 ref|XP_002322658.1| eukaryotic translation initiation factor 3E ... 59 9e-07 gb|AFK36338.1| unknown [Medicago truncatula] 58 1e-06 >emb|CBI33382.3| unnamed protein product [Vitis vinifera] Length = 383 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DSKSGTVVMEP+H NVY+QII+ TKA+S RTYK N +LE AQT AA Sbjct: 336 DSKSGTVVMEPNHPNVYQQIIDHTKAVSGRTYKLVNQLLEKAQTQAA 382 >ref|XP_002284533.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E [Vitis vinifera] Length = 437 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DSKSGTVVMEP+H NVY+QII+ TKA+S RTYK N +LE AQT AA Sbjct: 390 DSKSGTVVMEPNHPNVYQQIIDHTKAVSGRTYKLVNQLLEKAQTQAA 436 >gb|EYU18691.1| hypothetical protein MIMGU_mgv1a006587mg [Mimulus guttatus] Length = 438 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS++GT++MEP+H NVYEQ+I+ TKALS RTYK + +LE AQT AA Sbjct: 391 DSETGTIIMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQTQAA 437 >ref|XP_006491490.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Citrus sinensis] Length = 439 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 D+KSGTV+MEP+H NVYEQ+I+ TK LS RTYK +LE AQT AA Sbjct: 392 DAKSGTVIMEPTHPNVYEQLIDHTKGLSGRTYKLVGQLLEHAQTQAA 438 >ref|XP_004303635.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Fragaria vesca subsp. vesca] Length = 437 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS+SGTV+MEP+H NVYEQ+I+ TKALS RTYK + E AQT AA Sbjct: 390 DSQSGTVIMEPNHPNVYEQLIDHTKALSGRTYKLVGQIREHAQTQAA 436 >gb|AFK46442.1| unknown [Medicago truncatula] Length = 437 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS++GTV+ME +H NVYEQ+IE TKAL+ RTYK +LE AQ PAA Sbjct: 390 DSQTGTVIMEHNHPNVYEQLIEHTKALNSRTYKLVTQILEHAQAPAA 436 >gb|ACJ84594.1| unknown [Medicago truncatula] Length = 225 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS++GTV+ME +H NVYEQ+IE TKAL+ RTYK +LE AQ PAA Sbjct: 178 DSQTGTVIMEHNHPNVYEQLIEHTKALNSRTYKLVTQILEHAQAPAA 224 >ref|XP_002532670.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223527603|gb|EEF29717.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Length = 323 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DSKSGTV+MEP+H NVYEQ+I+ TK LS RT K N +LE +QT AA Sbjct: 276 DSKSGTVIMEPNHPNVYEQLIDHTKGLSGRTNKLVNQLLEHSQTQAA 322 >ref|XP_007202066.1| hypothetical protein PRUPE_ppa005923mg [Prunus persica] gi|462397597|gb|EMJ03265.1| hypothetical protein PRUPE_ppa005923mg [Prunus persica] Length = 437 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS+SGTV+MEP+H NVYEQ+I+ TKALS RTYK +LE AQ+ A Sbjct: 390 DSQSGTVIMEPNHPNVYEQLIDHTKALSGRTYKLVGQLLEHAQSQVA 436 >ref|XP_006421164.1| hypothetical protein CICLE_v10004983mg [Citrus clementina] gi|337733642|gb|AEI72270.1| eukaryotic translation initiation factor protein [Citrus trifoliata] gi|557523037|gb|ESR34404.1| hypothetical protein CICLE_v10004983mg [Citrus clementina] Length = 439 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 D+KSGTV+MEP+ NVYEQ+I+ TK LS RTYK +LE AQT AA Sbjct: 392 DAKSGTVIMEPTQPNVYEQLIDHTKGLSGRTYKLVGQLLEHAQTQAA 438 >ref|XP_006837958.1| hypothetical protein AMTR_s00102p00062980 [Amborella trichopoda] gi|548840373|gb|ERN00527.1| hypothetical protein AMTR_s00102p00062980 [Amborella trichopoda] Length = 438 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESA 127 DSKSGTVVM +H+NVYEQIIE+TK LS+RTY A VLE+A Sbjct: 390 DSKSGTVVMSTNHVNVYEQIIENTKQLSMRTYMLAKNVLEAA 431 >gb|EYU20768.1| hypothetical protein MIMGU_mgv1a006585mg [Mimulus guttatus] Length = 438 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPA 139 D+K+GT++MEP+H NVYEQ+I+ TKALS RTYK + ++E AQ A Sbjct: 391 DTKTGTIMMEPNHTNVYEQLIDHTKALSGRTYKLVSQLMEHAQVQA 436 >ref|XP_007145575.1| hypothetical protein PHAVU_007G250100g [Phaseolus vulgaris] gi|561018765|gb|ESW17569.1| hypothetical protein PHAVU_007G250100g [Phaseolus vulgaris] Length = 437 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS +GTV+MEP+H NVYEQ+I+ TKAL+ RTYK + +LE AQ AA Sbjct: 390 DSHTGTVIMEPNHPNVYEQLIDHTKALNGRTYKLVSQLLEHAQGQAA 436 >ref|XP_003519090.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Glycine max] Length = 437 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS++GTV+MEP+H NVYEQ+I+ TKAL+ RTYK + +LE AQ A Sbjct: 390 DSETGTVIMEPNHPNVYEQLIDHTKALNGRTYKLVSQLLEHAQAQTA 436 >ref|XP_004516371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Cicer arietinum] Length = 437 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS++GTV+MEP+H NVYEQ+I+ TKAL+ RTYK +LE Q AA Sbjct: 390 DSETGTVIMEPNHPNVYEQLIDHTKALNGRTYKLVTQLLEHGQAQAA 436 >ref|XP_003535892.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Glycine max] Length = 437 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQ 130 DS++G V+MEP+HLNVYEQ+I+ TKAL+ RTYK + +LE AQ Sbjct: 390 DSETGAVIMEPNHLNVYEQLIDHTKALNGRTYKLVSQLLEHAQ 432 >gb|ACU17653.1| unknown [Glycine max] Length = 323 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQ 130 DS++G V+MEP+HLNVYEQ+I+ TKAL+ RTYK + +LE AQ Sbjct: 276 DSETGAVIMEPNHLNVYEQLIDHTKALNGRTYKLVSQLLEHAQ 318 >ref|XP_002308015.1| eukaryotic translation initiation factor 3E family protein [Populus trichocarpa] gi|118488342|gb|ABK95989.1| unknown [Populus trichocarpa] gi|222853991|gb|EEE91538.1| eukaryotic translation initiation factor 3E family protein [Populus trichocarpa] Length = 437 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS+SGTV+MEP+H NVYEQ+I+ TKALS RT K + +LE AQ +A Sbjct: 390 DSQSGTVIMEPNHPNVYEQLIDHTKALSGRTSKLVSQILEHAQGQSA 436 >ref|XP_002322658.1| eukaryotic translation initiation factor 3E family protein [Populus trichocarpa] gi|222867288|gb|EEF04419.1| eukaryotic translation initiation factor 3E family protein [Populus trichocarpa] Length = 437 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS+SGTV+MEP+H NVYEQ+I+ TKALS RT K + +LE A AA Sbjct: 390 DSESGTVIMEPNHPNVYEQLIDHTKALSGRTSKSVSQILEHAHAQAA 436 >gb|AFK36338.1| unknown [Medicago truncatula] Length = 132 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +2 Query: 2 DSKSGTVVMEPSHLNVYEQIIESTKALSIRTYKYANLVLESAQTPAA 142 DS++GTV+MEP+ NVYEQ+I+ TKAL+ RTYK +LE AQ AA Sbjct: 85 DSETGTVIMEPNRPNVYEQLIDHTKALNGRTYKLVTQLLEQAQAQAA 131