BLASTX nr result
ID: Cocculus23_contig00004808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00004808 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase... 79 8e-13 emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] 79 8e-13 gb|AFK40073.1| unknown [Lotus japonicus] 78 1e-12 emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] 77 3e-12 emb|CAC24566.1| trypsin inhibitor [Pisum sativum] 77 3e-12 emb|CAC24564.1| trypsin inhibitor [Pisum sativum] 76 4e-12 emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] 76 4e-12 sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-ind... 76 5e-12 emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|... 76 5e-12 emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] 76 5e-12 emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp... 76 5e-12 emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp... 76 5e-12 emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|6... 76 5e-12 emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] 75 1e-11 ref|XP_004492724.1| PREDICTED: seed trypsin/chymotrypsin inhibit... 74 2e-11 gb|ADV40035.1| BBI inhibitor [Lathyrus sativus] 74 2e-11 gb|ADV40016.1| BBI inhibitor [Lathyrus sativus] gi|318086833|gb|... 74 2e-11 ref|NP_001236539.1| uncharacterized protein LOC100305522 precurs... 74 2e-11 ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like pre... 74 2e-11 ref|XP_003623947.1| Trypsin inhibitor [Medicago truncatula] gi|3... 74 3e-11 >sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase inhibitor; Short=LaBBI Length = 63 Score = 78.6 bits (192), Expect = 8e-13 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +2 Query: 32 PCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 PCC+S +CTRS PPQCRC D+ E C CK C CT S PP+C+C D T + + C Sbjct: 6 PCCDSCLCTRSIPPQCRCTDIGETCHSACKSCICTRSFPPQCRCSDITHFCYKPC 60 >emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] Length = 104 Score = 78.6 bits (192), Expect = 8e-13 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D CCNS CTRS PP+CRC D+ E C CK C CT S PP+C+C D T++ + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCRCTDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >gb|AFK40073.1| unknown [Lotus japonicus] Length = 119 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 CCNS CTRS PPQCRC D+ E C CK C CT S PP+C+CLD T++ + C Sbjct: 59 CCNSCPCTRSIPPQCRCTDIGETCHSACKACICTRSIPPQCRCLDITNFCYDPC 112 >emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] Length = 104 Score = 76.6 bits (187), Expect = 3e-12 Identities = 29/60 (48%), Positives = 37/60 (61%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D CCNS CTRS PP+C C D+ E C CK C CT S PP+C+C D T++ + +C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKKC 103 >emb|CAC24566.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 76.6 bits (187), Expect = 3e-12 Identities = 29/60 (48%), Positives = 37/60 (61%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D CC+S +CTRS PPQC+C D+ E C CK C CT S PP+C C D T + + +C Sbjct: 44 DASNKACCDSCLCTRSIPPQCQCNDIGETCHSACKACLCTRSLPPKCSCTDITDFCYKKC 103 >emb|CAC24564.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 76.3 bits (186), Expect = 4e-12 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 CC+S +CTRS PP+CRC D+ E C CK C CT S PP+C+C+D T + + +C Sbjct: 50 CCDSCLCTRSIPPRCRCNDIGETCHSACKTCICTRSLPPQCRCIDITDFCYEKC 103 >emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 CCN CTRS PPQCRC D+ E C CK C CT S PP+C+C D T++ + +C Sbjct: 59 CCNFCPCTRSIPPQCRCTDIGETCHSACKSCLCTRSIPPQCRCTDITNFCYPKC 112 >sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-induced trypsin inhibitor Length = 58 Score = 75.9 bits (185), Expect = 5e-12 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 CCN CTRS PPQCRC D+ E C CK C CT+S PP+C C D T++ + +C Sbjct: 4 CCNFCPCTRSIPPQCRCTDIGETCHSACKTCLCTKSIPPQCHCADITNFCYPKC 57 >emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|66840748|emb|CAH04449.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 75.9 bits (185), Expect = 5e-12 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D CCNS CTRS PP+C C D+ E C CK C CT S PP+C+C D T++ + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 75.9 bits (185), Expect = 5e-12 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D CCNS CTRS PP+C C D+ E C CK C CT S PP+C+C D T++ + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 75.9 bits (185), Expect = 5e-12 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D CCNS CTRS PP+C C D+ E C CK C CT S PP+C+C D T++ + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] gi|66840754|emb|CAH04452.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] Length = 104 Score = 75.9 bits (185), Expect = 5e-12 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D CCNS CTRS PP+C C D+ E C CK C CT S PP+C+C D T++ + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|66840740|emb|CAH04445.1| putative trypsin inhibitor [Lens culinaris] gi|66840744|emb|CAH04447.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 75.9 bits (185), Expect = 5e-12 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D CCNS CTRS PP+C C D+ E C CK C CT S PP+C+C D T++ + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 74.7 bits (182), Expect = 1e-11 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 CCN CT+S PPQCRC D+ E C CK C CT S PP+C+C D T++ + +C Sbjct: 59 CCNFCPCTKSIPPQCRCSDIGETCHSACKSCICTRSYPPQCRCTDITNFCYPKC 112 >ref|XP_004492724.1| PREDICTED: seed trypsin/chymotrypsin inhibitor TI5-72-like [Cicer arietinum] Length = 116 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRCPK 202 CC+S +CT+S PPQCRC D+ E C CK+C C S PP C+C+D T + + C K Sbjct: 56 CCDSCVCTKSIPPQCRCNDMGETCHSACKQCICALSYPPICRCMDNTGFCYDSCSK 111 >gb|ADV40035.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/60 (46%), Positives = 36/60 (60%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D K CC++ +CT+S PP CRC+DV E C C C C SNPP+CQC D + + C Sbjct: 44 DDAKSACCDTCLCTKSNPPTCRCVDVGETCHSACNRCICAYSNPPKCQCFDTQKFCYKAC 103 >gb|ADV40016.1| BBI inhibitor [Lathyrus sativus] gi|318086833|gb|ADV40017.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/60 (46%), Positives = 36/60 (60%) Frame = +2 Query: 17 DCGKPPCCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 D K CC++ +CT+S PP CRC+DV E C C C C SNPP+CQC D + + C Sbjct: 44 DDAKSACCDTCLCTKSNPPTCRCVDVGETCHSACNRCICAYSNPPKCQCFDTQKFCYKAC 103 >ref|NP_001236539.1| uncharacterized protein LOC100305522 precursor [Glycine max] gi|255625791|gb|ACU13240.1| unknown [Glycine max] Length = 117 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 CCNS CT+S PPQCRC D+ E C CK C CT S PP+C C D T++ + C Sbjct: 56 CCNSCPCTKSIPPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like precursor [Glycine max] gi|168259034|gb|ACA23206.1| putative Bowman-Birk type protease inhibitor [Glycine max] Length = 117 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 CCNS CT+S PPQCRC D+ E C CK C CT S PP+C C D T++ + C Sbjct: 56 CCNSCPCTKSIPPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >ref|XP_003623947.1| Trypsin inhibitor [Medicago truncatula] gi|355498962|gb|AES80165.1| Trypsin inhibitor [Medicago truncatula] gi|388499582|gb|AFK37857.1| unknown [Medicago truncatula] Length = 120 Score = 73.6 bits (179), Expect = 3e-11 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +2 Query: 35 CCNSEICTRSCPPQCRCLDVDEVCLGGCKECKCTESNPPECQCLDETSYQHLRC 196 CCNS CT+S PPQC C D+ E C CK C CT S PP+C+C D T + + C Sbjct: 58 CCNSCPCTKSIPPQCHCADIGEKCHSACKRCLCTRSFPPQCRCTDTTDFCYEPC 111