BLASTX nr result
ID: Cocculus23_contig00004661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00004661 (1031 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303863.1| hypothetical protein POPTR_0003s18280g [Popu... 60 1e-06 >ref|XP_002303863.1| hypothetical protein POPTR_0003s18280g [Populus trichocarpa] gi|118482072|gb|ABK92967.1| unknown [Populus trichocarpa] gi|222841295|gb|EEE78842.1| hypothetical protein POPTR_0003s18280g [Populus trichocarpa] Length = 230 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 356 EWPICVTYGAMAGYLIGLVVSAGFILVRGRREQRVKGD 243 EWPICVTYGAM GYL+G++ S+GF+L GRR QR+K D Sbjct: 194 EWPICVTYGAMTGYLVGMLASSGFVLANGRR-QRLKED 230