BLASTX nr result
ID: Cocculus23_contig00004474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00004474 (543 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282629.2| PREDICTED: probable L-type lectin-domain con... 59 1e-06 >ref|XP_002282629.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] Length = 661 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = +1 Query: 409 CGEGADLICFGSAVAGDGFLEVTPRPQQTNGTS--SSPNSVGRVLYR 543 CG G+ LIC GS AG+G+L +TP+P N TS SS N VGRVLYR Sbjct: 34 CGTGSKLICMGSVTAGEGYLNITPQPPHENETSPTSSTNMVGRVLYR 80