BLASTX nr result
ID: Cocculus23_contig00004136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00004136 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513126.1| DNA binding protein, putative [Ricinus commu... 57 4e-06 ref|XP_002306366.2| myb family transcription factor family prote... 56 5e-06 >ref|XP_002513126.1| DNA binding protein, putative [Ricinus communis] gi|223548137|gb|EEF49629.1| DNA binding protein, putative [Ricinus communis] Length = 295 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = +3 Query: 3 PPSAPGVGVYXXXXXXXXXXXXLISAVGTPVNLPAPGHMAYGLR 134 P +PGVGVY L+SAVGTPVNLPAP HMAYG+R Sbjct: 223 PAGSPGVGVYGSPTIGQPIGGPLVSAVGTPVNLPAPAHMAYGIR 266 >ref|XP_002306366.2| myb family transcription factor family protein [Populus trichocarpa] gi|550338443|gb|EEE93362.2| myb family transcription factor family protein [Populus trichocarpa] Length = 295 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/73 (39%), Positives = 33/73 (45%) Frame = +3 Query: 3 PPSAPGVGVYXXXXXXXXXXXXLISAVGTPVNLPAPGHMAYGLRXXXXXXXXXXXXXXXX 182 P PGVG+Y L+SAVGTPVNLPAP HMAYG+R Sbjct: 223 PVGPPGVGIYGPPTIGQPIGGPLVSAVGTPVNLPAPAHMAYGVRAPVPGTVVPGAPMNMV 282 Query: 183 XXXXXXXHASTHR 221 H +THR Sbjct: 283 PMTYPMPHTTTHR 295