BLASTX nr result
ID: Cocculus23_contig00003501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00003501 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO90254.1| pathogenesis-related (PR)-10-related norcoclaurin... 66 4e-09 >gb|ACO90254.1| pathogenesis-related (PR)-10-related norcoclaurine synthase-like protein [Eschscholzia californica] Length = 184 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -3 Query: 270 GCNSCVIVSKTEYEVPNKETANKVEPYISIDSLAEMAVAISTYVLERKKA 121 G NSC+I S T YEVPN+E KV P+ISIDSL MA AIS YVL++KK+ Sbjct: 110 GPNSCIIKSMTTYEVPNEEVGEKVSPFISIDSLVGMAEAISKYVLDKKKS 159