BLASTX nr result
ID: Cocculus23_contig00003163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00003163 (747 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359690.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_002275423.2| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 >ref|XP_006359690.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Solanum tuberosum] Length = 770 Score = 69.3 bits (168), Expect = 1e-09 Identities = 37/78 (47%), Positives = 43/78 (55%) Frame = -2 Query: 278 MSSIASPLPPKSKXXXXXXXXXXXXXXXXLDPLTQHLPHLSPSLIPTILFSPTLSSRPIT 99 MSS PL P L +LPHL+P +I +IL SPTLSSRP T Sbjct: 1 MSSSYPPLKPCQLVQTITTLLSSSARSLPKSSLQSYLPHLTPPIIHSILSSPTLSSRPST 60 Query: 98 LLSFFKWCQSHLPSFSHH 45 L SFF+W QSH+PSFS H Sbjct: 61 LFSFFQWSQSHIPSFSTH 78 >ref|XP_002275423.2| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Vitis vinifera] Length = 778 Score = 57.4 bits (137), Expect = 5e-06 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -2 Query: 182 LTQHLPHLSPSLIPTILFSPTLSSRPITLLSFFKWCQSHLPSFSHH 45 L ++PHL+P L+ +IL S TL SRP L+SFFKW Q++LP+F H+ Sbjct: 41 LNTYIPHLTPPLVLSILSSKTLISRPNILISFFKWAQTNLPTFPHN 86