BLASTX nr result
ID: Cocculus23_contig00001984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00001984 (748 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] 89 2e-15 emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] 88 4e-15 emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|... 87 5e-15 emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] 87 5e-15 gb|AFK40073.1| unknown [Lotus japonicus] 86 2e-14 sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase... 86 2e-14 emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp... 85 2e-14 emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp... 85 2e-14 emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|6... 85 2e-14 emb|CAC24566.1| trypsin inhibitor [Pisum sativum] 85 3e-14 emb|CAC24564.1| trypsin inhibitor [Pisum sativum] 84 5e-14 emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] 84 5e-14 ref|NP_001236539.1| uncharacterized protein LOC100305522 precurs... 84 7e-14 ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like pre... 84 7e-14 dbj|BAF35949.1| hypothetical protein [Coptis japonica] 83 9e-14 sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-ind... 82 2e-13 emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] 81 3e-13 emb|CAC24565.1| putative trypsin inhibitor [Pisum sativum] 81 3e-13 ref|XP_003623947.1| Trypsin inhibitor [Medicago truncatula] gi|3... 80 6e-13 gb|ACJ86027.1| unknown [Medicago truncatula] gi|388496776|gb|AFK... 80 8e-13 >emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] Length = 104 Score = 89.0 bits (219), Expect = 2e-15 Identities = 39/76 (51%), Positives = 45/76 (59%) Frame = +3 Query: 342 SVFVATSLAEKGNRRWDCGKPPCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIP 521 S F T L G D CCNS CTRS PP+CRC D+ E C CK+C CTRSIP Sbjct: 32 STFFITQLFSNG----DASNKACCNSCPCTRSIPPKCRCTDIGETCHSACKSCLCTRSIP 87 Query: 522 PQCQCLDVTLYQHLQC 569 PQC+C DVT + + C Sbjct: 88 PQCRCTDVTNFCYKNC 103 >emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] Length = 104 Score = 87.8 bits (216), Expect = 4e-15 Identities = 38/76 (50%), Positives = 45/76 (59%) Frame = +3 Query: 342 SVFVATSLAEKGNRRWDCGKPPCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIP 521 S F T L G D CCNS CTRS PP+C C D+ E C CK+C CTRSIP Sbjct: 32 STFFITQLFSNG----DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIP 87 Query: 522 PQCQCLDVTLYQHLQC 569 PQC+C DVT + + +C Sbjct: 88 PQCRCTDVTNFCYKKC 103 >emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|66840748|emb|CAH04449.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 87.4 bits (215), Expect = 5e-15 Identities = 40/90 (44%), Positives = 50/90 (55%) Frame = +3 Query: 300 ILTTSAGLDNIDLGSVFVATSLAEKGNRRWDCGKPPCCNSEVCTRSCPPQCRCGDVDEVC 479 +L +A + + S F T L G D CCNS CTRS PP+C C D+ E C Sbjct: 18 LLGFTATVADARFDSTFFITQLFANG----DASNKACCNSCPCTRSIPPKCSCSDIGETC 73 Query: 480 RGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CK+C CTRSIPPQC+C DVT + + C Sbjct: 74 HSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 87.4 bits (215), Expect = 5e-15 Identities = 38/76 (50%), Positives = 44/76 (57%) Frame = +3 Query: 342 SVFVATSLAEKGNRRWDCGKPPCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIP 521 S F T L G D CCNS CTRS PP+C C D+ E C CK+C CTRSIP Sbjct: 32 STFFITQLFSNG----DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIP 87 Query: 522 PQCQCLDVTLYQHLQC 569 PQC+C DVT + + C Sbjct: 88 PQCRCTDVTNFCYKNC 103 >gb|AFK40073.1| unknown [Lotus japonicus] Length = 119 Score = 85.5 bits (210), Expect = 2e-14 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = +3 Query: 408 CCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CCNS CTRS PPQCRC D+ E C CK C CTRSIPPQC+CLD+T + + C Sbjct: 59 CCNSCPCTRSIPPQCRCTDIGETCHSACKACICTRSIPPQCRCLDITNFCYDPC 112 >sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase inhibitor; Short=LaBBI Length = 63 Score = 85.5 bits (210), Expect = 2e-14 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +3 Query: 405 PCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 PCC+S +CTRS PPQCRC D+ E C CK+C CTRS PPQC+C D+T + + C Sbjct: 6 PCCDSCLCTRSIPPQCRCTDIGETCHSACKSCICTRSFPPQCRCSDITHFCYKPC 60 >emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 85.1 bits (209), Expect = 2e-14 Identities = 33/60 (55%), Positives = 39/60 (65%) Frame = +3 Query: 390 DCGKPPCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 D CCNS CTRS PP+C C D+ E C CK+C CTRSIPPQC+C DVT + + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] gi|66840754|emb|CAH04452.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] Length = 104 Score = 85.1 bits (209), Expect = 2e-14 Identities = 33/60 (55%), Positives = 39/60 (65%) Frame = +3 Query: 390 DCGKPPCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 D CCNS CTRS PP+C C D+ E C CK+C CTRSIPPQC+C DVT + + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|66840740|emb|CAH04445.1| putative trypsin inhibitor [Lens culinaris] gi|66840744|emb|CAH04447.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 85.1 bits (209), Expect = 2e-14 Identities = 33/60 (55%), Positives = 39/60 (65%) Frame = +3 Query: 390 DCGKPPCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 D CCNS CTRS PP+C C D+ E C CK+C CTRSIPPQC+C DVT + + C Sbjct: 44 DASNKACCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAC24566.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 84.7 bits (208), Expect = 3e-14 Identities = 37/90 (41%), Positives = 51/90 (56%) Frame = +3 Query: 300 ILTTSAGLDNIDLGSVFVATSLAEKGNRRWDCGKPPCCNSEVCTRSCPPQCRCGDVDEVC 479 +L +A + + GS T L G D CC+S +CTRS PPQC+C D+ E C Sbjct: 18 LLGFTATVVDARFGSTSFITQLLSNG----DASNKACCDSCLCTRSIPPQCQCNDIGETC 73 Query: 480 RGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CK C CTRS+PP+C C D+T + + +C Sbjct: 74 HSACKACLCTRSLPPKCSCTDITDFCYKKC 103 >emb|CAC24564.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 84.0 bits (206), Expect = 5e-14 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +3 Query: 408 CCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CC+S +CTRS PP+CRC D+ E C CK C CTRS+PPQC+C+D+T + + +C Sbjct: 50 CCDSCLCTRSIPPRCRCNDIGETCHSACKTCICTRSLPPQCRCIDITDFCYEKC 103 >emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 84.0 bits (206), Expect = 5e-14 Identities = 32/54 (59%), Positives = 39/54 (72%) Frame = +3 Query: 408 CCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CCN CTRS PPQCRC D+ E C CK+C CTRSIPPQC+C D+T + + +C Sbjct: 59 CCNFCPCTRSIPPQCRCTDIGETCHSACKSCLCTRSIPPQCRCTDITNFCYPKC 112 >ref|NP_001236539.1| uncharacterized protein LOC100305522 precursor [Glycine max] gi|255625791|gb|ACU13240.1| unknown [Glycine max] Length = 117 Score = 83.6 bits (205), Expect = 7e-14 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = +3 Query: 408 CCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CCNS CT+S PPQCRC D+ E C CK C CTRSIPPQC C D+T + + C Sbjct: 56 CCNSCPCTKSIPPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like precursor [Glycine max] gi|168259034|gb|ACA23206.1| putative Bowman-Birk type protease inhibitor [Glycine max] Length = 117 Score = 83.6 bits (205), Expect = 7e-14 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = +3 Query: 408 CCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CCNS CT+S PPQCRC D+ E C CK C CTRSIPPQC C D+T + + C Sbjct: 56 CCNSCPCTKSIPPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >dbj|BAF35949.1| hypothetical protein [Coptis japonica] Length = 98 Score = 83.2 bits (204), Expect = 9e-14 Identities = 41/87 (47%), Positives = 49/87 (56%) Frame = +3 Query: 291 IPSILTTSAGLDNIDLGSVFVATSLAEKGNRRWDCGKPPCCNSEVCTRSCPPQCRCGDVD 470 +P S GL I + VA +A +G+ CCN +CT+S PPQCRC DV Sbjct: 1 MPFTENQSKGLTEI---YIVVALEVAARGSNT------SCCNQCLCTKSIPPQCRCTDVK 51 Query: 471 EVCRGGCKNCRCTRSIPPQCQCLDVTL 551 E C C NC CTRSIPPQC+C DV L Sbjct: 52 EYCHSSCTNCLCTRSIPPQCRCTDVKL 78 >sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-induced trypsin inhibitor Length = 58 Score = 82.0 bits (201), Expect = 2e-13 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = +3 Query: 408 CCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CCN CTRS PPQCRC D+ E C CK C CT+SIPPQC C D+T + + +C Sbjct: 4 CCNFCPCTRSIPPQCRCTDIGETCHSACKTCLCTKSIPPQCHCADITNFCYPKC 57 >emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 81.3 bits (199), Expect = 3e-13 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +3 Query: 408 CCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CCN CT+S PPQCRC D+ E C CK+C CTRS PPQC+C D+T + + +C Sbjct: 59 CCNFCPCTKSIPPQCRCSDIGETCHSACKSCICTRSYPPQCRCTDITNFCYPKC 112 >emb|CAC24565.1| putative trypsin inhibitor [Pisum sativum] Length = 133 Score = 81.3 bits (199), Expect = 3e-13 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +3 Query: 390 DCGKPPCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQCLDVT 548 D CC+S +CT+S PP+CRC D E C CK C CTRS+PPQC+C+D+T Sbjct: 44 DASNKACCDSCLCTKSIPPRCRCNDTGETCHSACKTCICTRSLPPQCRCIDIT 96 >ref|XP_003623947.1| Trypsin inhibitor [Medicago truncatula] gi|355498962|gb|AES80165.1| Trypsin inhibitor [Medicago truncatula] gi|388499582|gb|AFK37857.1| unknown [Medicago truncatula] Length = 120 Score = 80.5 bits (197), Expect = 6e-13 Identities = 39/89 (43%), Positives = 48/89 (53%), Gaps = 2/89 (2%) Frame = +3 Query: 309 TSAGLDNIDLGSVFVATSLAEKGNRRWDCGKPP--CCNSEVCTRSCPPQCRCGDVDEVCR 482 TS +D GS F+ T L G ++ CCNS CT+S PPQC C D+ E C Sbjct: 24 TSTVVDARFDGSSFI-TQLLSNGEATYEVKSTTTACCNSCPCTKSIPPQCHCADIGEKCH 82 Query: 483 GGCKNCRCTRSIPPQCQCLDVTLYQHLQC 569 CK C CTRS PPQC+C D T + + C Sbjct: 83 SACKRCLCTRSFPPQCRCTDTTDFCYEPC 111 >gb|ACJ86027.1| unknown [Medicago truncatula] gi|388496776|gb|AFK36454.1| unknown [Medicago truncatula] Length = 110 Score = 80.1 bits (196), Expect = 8e-13 Identities = 33/71 (46%), Positives = 40/71 (56%) Frame = +3 Query: 357 TSLAEKGNRRWDCGKPPCCNSEVCTRSCPPQCRCGDVDEVCRGGCKNCRCTRSIPPQCQC 536 T L G CC+ CTRS PPQC+C DV E C CK+C CTRS PPQC+C Sbjct: 39 TQLLSNGEANTKSTTTACCDFCPCTRSIPPQCQCTDVKEKCHSACKSCLCTRSFPPQCRC 98 Query: 537 LDVTLYQHLQC 569 D+T + + C Sbjct: 99 YDITNFCYSSC 109