BLASTX nr result
ID: Cocculus23_contig00001890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00001890 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA91085.1| Ferritin 1, chloroplast precursor, putative, expr... 57 3e-06 gb|ACF79384.1| unknown [Zea mays] 56 5e-06 >gb|ABA91085.1| Ferritin 1, chloroplast precursor, putative, expressed [Oryza sativa Japonica Group] Length = 245 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 341 GGKVKLQAIVMPLTEFDHPEKGDALYGKCFLSC 243 GG+V+LQ+IV PLTEFDHPEKGDALYG+ +C Sbjct: 148 GGRVRLQSIVTPLTEFDHPEKGDALYGELLSAC 180 >gb|ACF79384.1| unknown [Zea mays] Length = 181 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 341 GGKVKLQAIVMPLTEFDHPEKGDALYGKCFLSCVR 237 GG+V+LQ+IV PLTEFDHPEKGDALYGK L C R Sbjct: 148 GGRVRLQSIVAPLTEFDHPEKGDALYGK--LRCRR 180