BLASTX nr result
ID: Cocculus23_contig00001608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00001608 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltNa... 82 1e-13 ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [G... 81 1e-13 ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citr... 80 2e-13 ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula] gi... 80 2e-13 ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [C... 80 3e-13 ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [G... 80 3e-13 ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [C... 80 4e-13 ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phas... 79 5e-13 dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus] 79 5e-13 emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [... 79 5e-13 dbj|BAC41322.1| hypothetical protein [Lotus japonicus] 79 6e-13 gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform... 79 6e-13 gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform... 79 6e-13 gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform... 79 6e-13 gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas] 79 6e-13 gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform... 79 6e-13 gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform... 79 6e-13 dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus] 79 6e-13 ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Popu... 79 6e-13 gb|ABK94801.1| unknown [Populus trichocarpa] 79 6e-13 >sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13 gi|18086|emb|CAA27609.1| pot. cysteine proteinase [Carica papaya] Length = 96 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQ 122 KNSWGENWGENGYYKICRGRN+CGVDSMVSTVAA T+Q Sbjct: 57 KNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTSQ 96 >ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max] Length = 363 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQ 122 KNSWGENWGENGYYKICRGRN+CGVDSMVSTVAA T Q Sbjct: 324 KNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTTQ 363 >ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina] gi|557525337|gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina] Length = 375 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIK 113 KNSWGE+WGENGYYKICRGRNVCGVDSMVST+AAA++ Sbjct: 338 KNSWGESWGENGYYKICRGRNVCGVDSMVSTIAAAVR 374 >ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula] gi|355508165|gb|AES89307.1| Cysteine proteinase [Medicago truncatula] Length = 331 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQ 122 KNSWGE WGENGYYKICRGRN+CGVDSMVSTVAAA T Q Sbjct: 292 KNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTTTQ 331 >ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis] Length = 373 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAI 110 KNSWGE+WGENGYYKICRGRNVCGVDSMVSTVAAA+ Sbjct: 338 KNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAAV 373 >ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max] Length = 365 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQ 122 KNSWGENWGENGYYKICRGRN+CGVDSMVSTVA+ T Q Sbjct: 326 KNSWGENWGENGYYKICRGRNICGVDSMVSTVASVHTTTQ 365 >ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum] Length = 363 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQ 122 KNSWGENWGENG+YKICRGRN+CGVDSMVSTVAA T Q Sbjct: 324 KNSWGENWGENGFYKICRGRNICGVDSMVSTVAAVHTTTQ 363 >ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris] gi|561004787|gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris] Length = 361 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKT 116 KNSWGENWGENGYYKICRGRN+CGVDSMVSTVAA T Sbjct: 322 KNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTT 359 >dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus] Length = 360 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA 104 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA Sbjct: 321 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA 354 >emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus] Length = 361 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA 104 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA Sbjct: 322 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA 355 >dbj|BAC41322.1| hypothetical protein [Lotus japonicus] Length = 358 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA 104 KNSWGENWGENGYYKICRGRN+CGVDSMVSTVAA Sbjct: 321 KNSWGENWGENGYYKICRGRNICGVDSMVSTVAA 354 >gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas] Length = 366 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQE 125 KNSWGE+WGENGYYKICRGRNVCGVDSMVSTVAA T + Sbjct: 326 KNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD 366 >gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas] Length = 368 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQE 125 KNSWGE+WGENGYYKICRGRNVCGVDSMVSTVAA T + Sbjct: 328 KNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD 368 >gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas] Length = 368 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQE 125 KNSWGE+WGENGYYKICRGRNVCGVDSMVSTVAA T + Sbjct: 328 KNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD 368 >gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas] Length = 366 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQE 125 KNSWGE+WGENGYYKICRGRNVCGVDSMVSTVAA T + Sbjct: 326 KNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD 366 >gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas] gi|7381223|gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas] Length = 366 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQE 125 KNSWGE+WGENGYYKICRGRNVCGVDSMVSTVAA T + Sbjct: 326 KNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD 366 >gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas] Length = 368 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQE 125 KNSWGE+WGENGYYKICRGRNVCGVDSMVSTVAA T + Sbjct: 328 KNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD 368 >dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus] Length = 360 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA 104 KNSWGENWGENGYYKICRGRN+CGVDSMVSTVAA Sbjct: 321 KNSWGENWGENGYYKICRGRNICGVDSMVSTVAA 354 >ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa] gi|118485796|gb|ABK94746.1| unknown [Populus trichocarpa] gi|550344165|gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa] Length = 367 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQ 122 KNSWG+NWGENGYYKICRGRN+CGVDSMVSTVAA T Q Sbjct: 328 KNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHTTAQ 367 >gb|ABK94801.1| unknown [Populus trichocarpa] Length = 367 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 3 KNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAAIKTNQ 122 KNSWG+NWGENGYYKICRGRN+CGVDSMVSTVAA T Q Sbjct: 328 KNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHTTAQ 367