BLASTX nr result
ID: Cocculus23_contig00000100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00000100 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW72615.1| polygalacturonase-inhibiting protein [Prunus pers... 132 4e-29 gb|AAW72616.1| polygalacturonase-inhibiting protein [Prunus pers... 132 4e-29 gb|AAW72619.1| polygalacturonase-inhibiting protein [Prunus mume... 132 4e-29 ref|XP_007203885.1| hypothetical protein PRUPE_ppa008474mg [Prun... 131 9e-29 gb|AAV33432.1| polygalacturonase inhibiting protein [Prunus mume] 131 9e-29 gb|AAQ56728.1| polygalacturonase inhibiting protein [Prunus pers... 131 9e-29 gb|AAF79181.1| polygalacturonase inhibiting protein [Prunus maha... 130 1e-28 gb|ABA42120.1| polygalacturonase inhibiting protein [Prunus sali... 130 2e-28 gb|ACY41031.1| polygalacturonase inhibiting protein [Prunus frut... 130 2e-28 gb|ABO26221.1| polygalacturonase inhibiting protein [Prunus pers... 129 3e-28 emb|CAA88846.1| polygalacturonase inhibitor [Actinidia deliciosa] 129 4e-28 ref|XP_007202219.1| hypothetical protein PRUPE_ppa008479mg [Prun... 129 6e-28 gb|AAW57429.1| polygalacturonase-inhibiting protein [Prunus amer... 129 6e-28 gb|AAY32955.1| polygalacturonase-inhibiting protein [Prunus sali... 129 6e-28 ref|NP_001268106.1| polygalacturonase inhibitor precursor [Vitis... 128 7e-28 gb|AFQ39765.1| polygalacturonase-inhibiting protein [Vitis ciner... 128 7e-28 gb|AEP27185.1| polygalacturonase-inhibiting protein 4 [Vitis thu... 128 7e-28 gb|ABU82741.1| polygalacturonase-inhibiting protein [Vitis thunb... 128 7e-28 emb|CBI29913.3| unnamed protein product [Vitis vinifera] 128 7e-28 gb|ACS16072.1| polygalacturonase-inhibiting protein [Vitis labru... 128 7e-28 >gb|AAW72615.1| polygalacturonase-inhibiting protein [Prunus persica] Length = 330 Score = 132 bits (333), Expect = 4e-29 Identities = 60/84 (71%), Positives = 69/84 (82%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV FSK LISLD+NHNKI G +P+ +T+LDLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAW72616.1| polygalacturonase-inhibiting protein [Prunus persica] Length = 330 Score = 132 bits (333), Expect = 4e-29 Identities = 60/84 (71%), Positives = 69/84 (82%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV FSK LISLD+NHNKI G +P+ +T+LDLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAW72619.1| polygalacturonase-inhibiting protein [Prunus mume] gi|58379372|gb|AAW72620.1| polygalacturonase-inhibiting protein [Prunus mume] Length = 330 Score = 132 bits (333), Expect = 4e-29 Identities = 60/84 (71%), Positives = 69/84 (82%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV FSK LISLD+NHNKI G +P+ +T+LDLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >ref|XP_007203885.1| hypothetical protein PRUPE_ppa008474mg [Prunus persica] gi|462399416|gb|EMJ05084.1| hypothetical protein PRUPE_ppa008474mg [Prunus persica] Length = 330 Score = 131 bits (330), Expect = 9e-29 Identities = 59/84 (70%), Positives = 69/84 (82%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV FSK LISLD+NHNKI G +P+ +T++DLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQVDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAV33432.1| polygalacturonase inhibiting protein [Prunus mume] Length = 330 Score = 131 bits (330), Expect = 9e-29 Identities = 59/84 (70%), Positives = 69/84 (82%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV FSK LISLD+NHNKI G +P+ +T++DLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQVDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAQ56728.1| polygalacturonase inhibiting protein [Prunus persica] Length = 330 Score = 131 bits (330), Expect = 9e-29 Identities = 59/84 (70%), Positives = 69/84 (82%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV FSK LISLD+NHNKI G +P+ +T++DLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQVDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAF79181.1| polygalacturonase inhibiting protein [Prunus mahaleb] Length = 330 Score = 130 bits (328), Expect = 1e-28 Identities = 59/84 (70%), Positives = 68/84 (80%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV FSK L SLD+NHNKI G +P+ +T+LDLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVEFSKSLTSLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|ABA42120.1| polygalacturonase inhibiting protein [Prunus salicina] Length = 330 Score = 130 bits (327), Expect = 2e-28 Identities = 59/84 (70%), Positives = 67/84 (79%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ S V FSK L SLD+NHNKI G +P+ +TKLDLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSNVEFSKSLTSLDLNHNKITGGIPVGLTKLDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|ACY41031.1| polygalacturonase inhibiting protein [Prunus fruticosa] Length = 330 Score = 130 bits (326), Expect = 2e-28 Identities = 58/84 (69%), Positives = 69/84 (82%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV+FSK LISLD+NHN I G +P+ +T++DLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVKFSKSLISLDLNHNMITGGIPVGLTQVDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|ABO26221.1| polygalacturonase inhibiting protein [Prunus persica] Length = 330 Score = 129 bits (325), Expect = 3e-28 Identities = 58/84 (69%), Positives = 69/84 (82%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ SKV FSK L SLD+NHNKI GS+P+ +T++DLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSKVEFSKSLTSLDLNHNKITGSIPVGLTQVDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S Y HN+CLCG PLP C+ Sbjct: 307 LQSFDSSTYIHNQCLCGAPLPSCK 330 >emb|CAA88846.1| polygalacturonase inhibitor [Actinidia deliciosa] Length = 327 Score = 129 bits (324), Expect = 4e-28 Identities = 58/84 (69%), Positives = 68/84 (80%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRN F+FD SKV F + L SLD+NHNKI+GSLP+ +TKLDLQ+LNVSYNRLCG IP GG+ Sbjct: 244 SRNKFQFDLSKVVFPQSLTSLDLNHNKIYGSLPVGLTKLDLQYLNVSYNRLCGHIPTGGK 303 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D + YFHN CLCG PLP C+ Sbjct: 304 LQGFDQTSYFHNRCLCGAPLPDCK 327 >ref|XP_007202219.1| hypothetical protein PRUPE_ppa008479mg [Prunus persica] gi|462397750|gb|EMJ03418.1| hypothetical protein PRUPE_ppa008479mg [Prunus persica] Length = 330 Score = 129 bits (323), Expect = 6e-28 Identities = 58/84 (69%), Positives = 68/84 (80%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EFD SKV+FSK L SLD+NHNKI GS+P+ +T+ DLQ+LNV YNRLCG+IP GG+ Sbjct: 247 SRNLLEFDLSKVKFSKSLTSLDLNHNKIAGSIPVGLTQGDLQYLNVCYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAW57429.1| polygalacturonase-inhibiting protein [Prunus americana] gi|57868643|gb|AAW57430.1| polygalacturonase-inhibiting protein [Prunus americana] Length = 330 Score = 129 bits (323), Expect = 6e-28 Identities = 58/84 (69%), Positives = 67/84 (79%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ S V FSK L SLD+NHNKI G +P+ +T+LDLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSNVEFSKSLTSLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAY32955.1| polygalacturonase-inhibiting protein [Prunus salicina] Length = 330 Score = 129 bits (323), Expect = 6e-28 Identities = 58/84 (69%), Positives = 67/84 (79%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNL EF+ S V FSK L SLD+NHNKI G +P+ +T+LDLQFLNVSYNRLCG+IP GG+ Sbjct: 247 SRNLLEFNLSNVEFSKSLTSLDLNHNKITGGIPVGLTQLDLQFLNVSYNRLCGQIPVGGK 306 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ D S YFHN CLCG PLP C+ Sbjct: 307 LQSFDSSTYFHNRCLCGAPLPSCK 330 >ref|NP_001268106.1| polygalacturonase inhibitor precursor [Vitis vinifera] gi|13172312|gb|AAK14075.1|AF305093_1 polygalacturonase inhibiting protein [Vitis vinifera] Length = 333 Score = 128 bits (322), Expect = 7e-28 Identities = 59/84 (70%), Positives = 66/84 (78%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNLF+FD S+V F K L SLD++HNKI GSLP MT LDLQFLNVSYNRLCG+IP GG+ Sbjct: 250 SRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGK 309 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ DY YFHN CLCG PL C+ Sbjct: 310 LQSFDYDSYFHNRCLCGAPLQSCK 333 >gb|AFQ39765.1| polygalacturonase-inhibiting protein [Vitis cinerea var. helleri x Vitis riparia] Length = 333 Score = 128 bits (322), Expect = 7e-28 Identities = 59/84 (70%), Positives = 66/84 (78%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNLF+FD S+V F K L SLD++HNKI GSLP MT LDLQFLNVSYNRLCG+IP GG+ Sbjct: 250 SRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGK 309 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ DY YFHN CLCG PL C+ Sbjct: 310 LQSFDYDSYFHNRCLCGAPLQSCK 333 >gb|AEP27185.1| polygalacturonase-inhibiting protein 4 [Vitis thunbergii] Length = 333 Score = 128 bits (322), Expect = 7e-28 Identities = 59/84 (70%), Positives = 66/84 (78%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNLF+FD S+V F K L SLD++HNKI GSLP MT LDLQFLNVSYNRLCG+IP GG+ Sbjct: 250 SRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGK 309 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ DY YFHN CLCG PL C+ Sbjct: 310 LQSFDYDSYFHNRCLCGAPLQSCK 333 >gb|ABU82741.1| polygalacturonase-inhibiting protein [Vitis thunbergii] Length = 333 Score = 128 bits (322), Expect = 7e-28 Identities = 59/84 (70%), Positives = 66/84 (78%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNLF+FD S+V F K L SLD++HNKI GSLP MT LDLQFLNVSYNRLCG+IP GG+ Sbjct: 250 SRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGK 309 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ DY YFHN CLCG PL C+ Sbjct: 310 LQSFDYDSYFHNRCLCGAPLQSCK 333 >emb|CBI29913.3| unnamed protein product [Vitis vinifera] Length = 320 Score = 128 bits (322), Expect = 7e-28 Identities = 59/84 (70%), Positives = 66/84 (78%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNLF+FD S+V F K L SLD++HNKI GSLP MT LDLQFLNVSYNRLCG+IP GG+ Sbjct: 226 SRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGK 285 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ DY YFHN CLCG PL C+ Sbjct: 286 LQSFDYDSYFHNRCLCGAPLQSCK 309 >gb|ACS16072.1| polygalacturonase-inhibiting protein [Vitis labrusca x Vitis riparia] gi|402239634|gb|AFQ39768.1| polygalacturonase-inhibiting protein [Vitis labrusca] Length = 333 Score = 128 bits (322), Expect = 7e-28 Identities = 59/84 (70%), Positives = 66/84 (78%) Frame = -3 Query: 330 SRNLFEFDFSKVRFSKKLISLDINHNKIFGSLPMEMTKLDLQFLNVSYNRLCGEIPRGGR 151 SRNLF+FD S+V F K L SLD++HNKI GSLP MT LDLQFLNVSYNRLCG+IP GG+ Sbjct: 250 SRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSLDLQFLNVSYNRLCGKIPVGGK 309 Query: 150 LQDNDYSVYFHNECLCGPPLPKCR 79 LQ DY YFHN CLCG PL C+ Sbjct: 310 LQSFDYDSYFHNRCLCGAPLQSCK 333