BLASTX nr result
ID: Cocculus22_contig00003274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00003274 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006288273.1| hypothetical protein CARUB_v10001519mg [Caps... 60 2e-07 ref|XP_002867786.1| plant UBX domain-containing protein 3 [Arabi... 60 2e-07 ref|XP_006396709.1| hypothetical protein EUTSA_v10028833mg [Eutr... 60 4e-07 ref|XP_006413687.1| hypothetical protein EUTSA_v10025821mg [Eutr... 59 9e-07 gb|AAC28225.1| contains similarity to rat p47 protein (GB:AB0020... 58 2e-06 ref|XP_002872684.1| plant UBX domain-containing protein 4 [Arabi... 58 2e-06 ref|NP_567262.1| CDC48-interacting UBX-domain protein 4 [Arabido... 58 2e-06 ref|XP_006284158.1| hypothetical protein CARUB_v10005291mg [Caps... 57 2e-06 ref|XP_007026187.1| Plant UBX domain containing protein 4 [Theob... 57 3e-06 emb|CAB52871.1| putative protein [Arabidopsis thaliana] gi|72690... 57 3e-06 ref|NP_193946.2| CDC48-interacting UBX-domain protein PUX3 [Arab... 57 3e-06 ref|XP_006467372.1| PREDICTED: UBA and UBX domain-containing pro... 56 6e-06 ref|XP_006449810.1| hypothetical protein CICLE_v10016067mg [Citr... 56 6e-06 >ref|XP_006288273.1| hypothetical protein CARUB_v10001519mg [Capsella rubella] gi|482556979|gb|EOA21171.1| hypothetical protein CARUB_v10001519mg [Capsella rubella] Length = 311 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -1 Query: 267 MSSRYKKPAW--SGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 MSS+ KKPA S G+IRTL+DLNRR+ P SDSDS+GP+E TGGEK Sbjct: 1 MSSKDKKPAKPSSSRGKIRTLSDLNRRSGPDSDSDSDGPQEYYTGGEK 48 >ref|XP_002867786.1| plant UBX domain-containing protein 3 [Arabidopsis lyrata subsp. lyrata] gi|297313622|gb|EFH44045.1| plant UBX domain-containing protein 3 [Arabidopsis lyrata subsp. lyrata] Length = 302 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/49 (65%), Positives = 39/49 (79%), Gaps = 3/49 (6%) Frame = -1 Query: 267 MSSRYKKPAWSGAGR---IRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 MSS+ KKPA +GR IRTL+DLNRR++P SDSDS+GP+E TGGEK Sbjct: 1 MSSKDKKPAKPTSGRTGGIRTLSDLNRRSEPDSDSDSDGPQEYYTGGEK 49 >ref|XP_006396709.1| hypothetical protein EUTSA_v10028833mg [Eutrema salsugineum] gi|557097726|gb|ESQ38162.1| hypothetical protein EUTSA_v10028833mg [Eutrema salsugineum] Length = 305 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/49 (65%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = -1 Query: 267 MSSRYKKPAW---SGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 MSS+ KKPA S G+IRTL+DLNRR+ P SDSDS+GP+E TGGEK Sbjct: 1 MSSKDKKPARPSSSRVGKIRTLSDLNRRSGPDSDSDSDGPQEYYTGGEK 49 >ref|XP_006413687.1| hypothetical protein EUTSA_v10025821mg [Eutrema salsugineum] gi|557114857|gb|ESQ55140.1| hypothetical protein EUTSA_v10025821mg [Eutrema salsugineum] Length = 304 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/49 (63%), Positives = 37/49 (75%), Gaps = 3/49 (6%) Frame = -1 Query: 267 MSSRYKKPAWSGAGR---IRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 MSS+ KKP+ GR IRTL+DLNRR+ P SDSDS+GP+E TGGEK Sbjct: 1 MSSKDKKPSKPSGGRTGHIRTLSDLNRRSGPDSDSDSDGPQEYFTGGEK 49 >gb|AAC28225.1| contains similarity to rat p47 protein (GB:AB002086) [Arabidopsis thaliana] gi|7267177|emb|CAB77889.1| putative membrane trafficking factor [Arabidopsis thaliana] Length = 308 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = -1 Query: 267 MSSRYKKPAW--SGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 MSS+ KKP+ S G IRTL+DLNRR+ P SDSDS+GP+E TGGEK Sbjct: 1 MSSKDKKPSKPSSSRGGIRTLSDLNRRSGPDSDSDSDGPQEYYTGGEK 48 >ref|XP_002872684.1| plant UBX domain-containing protein 4 [Arabidopsis lyrata subsp. lyrata] gi|297318521|gb|EFH48943.1| plant UBX domain-containing protein 4 [Arabidopsis lyrata subsp. lyrata] Length = 306 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/48 (64%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = -1 Query: 267 MSSRYKKPAWSGAGR--IRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 MSS+ KKPA R IRTL+DLNRR+ P SDSDS+GP+E TGGEK Sbjct: 1 MSSKDKKPARPSTSRGGIRTLSDLNRRSGPDSDSDSDGPQEYYTGGEK 48 >ref|NP_567262.1| CDC48-interacting UBX-domain protein 4 [Arabidopsis thaliana] gi|20268692|gb|AAM14050.1| putative membrane trafficking factor [Arabidopsis thaliana] gi|21553471|gb|AAM62564.1| putative membrane trafficking factor [Arabidopsis thaliana] gi|21689865|gb|AAM67493.1| putative membrane trafficking factor [Arabidopsis thaliana] gi|45862328|gb|AAS78926.1| CDC48-interacting UBX-domain protein [Arabidopsis thaliana] gi|332656974|gb|AEE82374.1| CDC48-interacting UBX-domain protein 4 [Arabidopsis thaliana] Length = 303 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = -1 Query: 267 MSSRYKKPAW--SGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 MSS+ KKP+ S G IRTL+DLNRR+ P SDSDS+GP+E TGGEK Sbjct: 1 MSSKDKKPSKPSSSRGGIRTLSDLNRRSGPDSDSDSDGPQEYYTGGEK 48 >ref|XP_006284158.1| hypothetical protein CARUB_v10005291mg [Capsella rubella] gi|482552863|gb|EOA17056.1| hypothetical protein CARUB_v10005291mg [Capsella rubella] Length = 313 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 3/49 (6%) Frame = -1 Query: 267 MSSRYKKPAWSGAGR---IRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 M+S+ KKP+ GR IRTL+DLNRR+ P SDSDS+GP+E TGGEK Sbjct: 12 MASKDKKPSKPATGRTGGIRTLSDLNRRSGPDSDSDSDGPQEYYTGGEK 60 >ref|XP_007026187.1| Plant UBX domain containing protein 4 [Theobroma cacao] gi|508781553|gb|EOY28809.1| Plant UBX domain containing protein 4 [Theobroma cacao] Length = 306 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 4/50 (8%) Frame = -1 Query: 267 MSSRYKKPAW----SGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 M+SR KKPA S AG IRTL+DLNRR+ P SDSDS+ P+E TGGEK Sbjct: 1 MASRDKKPAKPSSSSRAGGIRTLSDLNRRSGPDSDSDSDSPQEYYTGGEK 50 >emb|CAB52871.1| putative protein [Arabidopsis thaliana] gi|7269060|emb|CAB79170.1| putative protein [Arabidopsis thaliana] gi|34146866|gb|AAQ62441.1| At4g22150 [Arabidopsis thaliana] gi|45862326|gb|AAS78925.1| CDC48-interacting UBX-domain protein [Arabidopsis thaliana] gi|51970624|dbj|BAD44004.1| putative protein [Arabidopsis thaliana] Length = 302 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -1 Query: 273 SAMSSRYKKPAWSGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 S+ + KP G IRTL+DLNRR++P SDSDS+GP+E TGGEK Sbjct: 2 SSKDKKLSKPTSGRTGGIRTLSDLNRRSEPDSDSDSDGPQEYFTGGEK 49 >ref|NP_193946.2| CDC48-interacting UBX-domain protein PUX3 [Arabidopsis thaliana] gi|332659164|gb|AEE84564.1| CDC48-interacting UBX-domain protein PUX3 [Arabidopsis thaliana] Length = 367 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -1 Query: 273 SAMSSRYKKPAWSGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 S+ + KP G IRTL+DLNRR++P SDSDS+GP+E TGGEK Sbjct: 67 SSKDKKLSKPTSGRTGGIRTLSDLNRRSEPDSDSDSDGPQEYFTGGEK 114 >ref|XP_006467372.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like [Citrus sinensis] Length = 304 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 3/49 (6%) Frame = -1 Query: 267 MSSRYKKPAW---SGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 M+SR KKPA S AG IRTL+DLNRR+ P SDSD + P+E TGGEK Sbjct: 1 MASRDKKPAKPSSSRAGGIRTLSDLNRRSGPDSDSDDDAPQEYYTGGEK 49 >ref|XP_006449810.1| hypothetical protein CICLE_v10016067mg [Citrus clementina] gi|557552421|gb|ESR63050.1| hypothetical protein CICLE_v10016067mg [Citrus clementina] Length = 304 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 3/49 (6%) Frame = -1 Query: 267 MSSRYKKPAW---SGAGRIRTLTDLNRRTDPGSDSDSNGPEEN*TGGEK 130 M+SR KKPA S AG IRTL+DLNRR+ P SDSD + P+E TGGEK Sbjct: 1 MASRDKKPAKPSSSRAGGIRTLSDLNRRSGPDSDSDDDAPQEYYTGGEK 49