BLASTX nr result
ID: Cocculus22_contig00003205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00003205 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451455.1| hypothetical protein CICLE_v10010770mg, part... 90 2e-16 ref|XP_002309975.2| transducin family protein [Populus trichocar... 90 3e-16 ref|XP_002282252.1| PREDICTED: glutamate-rich WD repeat-containi... 90 3e-16 ref|XP_006493908.1| PREDICTED: glutamate-rich WD repeat-containi... 90 4e-16 ref|XP_006421443.1| hypothetical protein CICLE_v10004888mg [Citr... 90 4e-16 ref|XP_007202010.1| hypothetical protein PRUPE_ppa005177mg [Prun... 88 1e-15 ref|XP_002527727.1| WD-repeat protein, putative [Ricinus communi... 86 4e-15 ref|XP_006350988.1| PREDICTED: glutamate-rich WD repeat-containi... 86 7e-15 ref|XP_006346562.1| PREDICTED: glutamate-rich WD repeat-containi... 86 7e-15 ref|XP_006346561.1| PREDICTED: glutamate-rich WD repeat-containi... 86 7e-15 ref|XP_004243762.1| PREDICTED: glutamate-rich WD repeat-containi... 86 7e-15 ref|XP_004243761.1| PREDICTED: glutamate-rich WD repeat-containi... 86 7e-15 ref|NP_001275436.1| glutamate-rich WD repeat-containing protein ... 86 7e-15 ref|XP_002886033.1| transducin family protein [Arabidopsis lyrat... 86 7e-15 ref|NP_179544.1| transducin family protein / WD-40 repeat family... 86 7e-15 ref|XP_006580121.1| PREDICTED: glutamate-rich WD repeat-containi... 85 1e-14 ref|XP_006585120.1| PREDICTED: glutamate-rich WD repeat-containi... 85 1e-14 ref|XP_007139165.1| hypothetical protein PHAVU_008G006800g [Phas... 85 1e-14 gb|ACU20888.1| unknown [Glycine max] 85 1e-14 ref|XP_003612352.1| Glutamate-rich WD repeat-containing protein ... 84 2e-14 >ref|XP_006451455.1| hypothetical protein CICLE_v10010770mg, partial [Citrus clementina] gi|557554681|gb|ESR64695.1| hypothetical protein CICLE_v10010770mg, partial [Citrus clementina] Length = 490 Score = 89.7 bits (221), Expect(2) = 2e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 +IPSLPTKVWQPGVD LEEGEELQCDP+AYNSLHAFHIGWP Sbjct: 43 SIPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWP 83 Score = 21.2 bits (43), Expect(2) = 2e-16 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 206 WFEV*KILKRQNERTRALRREKG 138 WF + +R ERTR ++ G Sbjct: 16 WFAASRTQRRPKERTRTQKKGNG 38 >ref|XP_002309975.2| transducin family protein [Populus trichocarpa] gi|550334174|gb|EEE90425.2| transducin family protein [Populus trichocarpa] Length = 459 Score = 90.1 bits (222), Expect = 3e-16 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 +IPS+PTKVWQPGVDNLEEGEEL+CDP+AYNSLHAFHIGWP Sbjct: 26 SIPSMPTKVWQPGVDNLEEGEELECDPTAYNSLHAFHIGWP 66 >ref|XP_002282252.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Vitis vinifera] gi|297738673|emb|CBI27918.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 90.1 bits (222), Expect = 3e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 ++PSLPTKVWQPGVD LEEGEELQCDPSAYNSLHAFH+GWP Sbjct: 26 SVPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHVGWP 66 >ref|XP_006493908.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X1 [Citrus sinensis] gi|568882164|ref|XP_006493909.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X2 [Citrus sinensis] gi|568882166|ref|XP_006493910.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X3 [Citrus sinensis] gi|568882168|ref|XP_006493911.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X4 [Citrus sinensis] gi|568882170|ref|XP_006493912.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X5 [Citrus sinensis] Length = 475 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 +IPSLPTKVWQPGVD LEEGEELQCDP+AYNSLHAFHIGWP Sbjct: 28 SIPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWP 68 >ref|XP_006421443.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|567857522|ref|XP_006421444.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|557523316|gb|ESR34683.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|557523317|gb|ESR34684.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] Length = 475 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 +IPSLPTKVWQPGVD LEEGEELQCDP+AYNSLHAFHIGWP Sbjct: 28 SIPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWP 68 >ref|XP_007202010.1| hypothetical protein PRUPE_ppa005177mg [Prunus persica] gi|462397541|gb|EMJ03209.1| hypothetical protein PRUPE_ppa005177mg [Prunus persica] Length = 473 Score = 87.8 bits (216), Expect = 1e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 120 IPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 IPS+P KVWQPGVD LEEGEELQCDPSAYNSLHAFHIGWP Sbjct: 29 IPSMPAKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWP 68 >ref|XP_002527727.1| WD-repeat protein, putative [Ricinus communis] gi|223532868|gb|EEF34640.1| WD-repeat protein, putative [Ricinus communis] Length = 476 Score = 86.3 bits (212), Expect = 4e-15 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 +IP++PTKVWQPGVD LEEGEEL+CDPSAYNSLH FHIGWP Sbjct: 27 SIPTMPTKVWQPGVDKLEEGEELECDPSAYNSLHGFHIGWP 67 >ref|XP_006350988.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Solanum tuberosum] Length = 463 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 ++PSL KVWQPGVD LEEGEELQCDPSAYNSLHAFHIGWP Sbjct: 24 SVPSLAAKVWQPGVDELEEGEELQCDPSAYNSLHAFHIGWP 64 >ref|XP_006346562.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 469 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 ++PSLP KVWQPGVD LEEGEELQCD SAYNSLHAFHIGWP Sbjct: 26 SVPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWP 66 >ref|XP_006346561.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X1 [Solanum tuberosum] Length = 470 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 ++PSLP KVWQPGVD LEEGEELQCD SAYNSLHAFHIGWP Sbjct: 27 SVPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWP 67 >ref|XP_004243762.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform 2 [Solanum lycopersicum] Length = 468 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 ++PSLP KVWQPGVD LEEGEELQCD SAYNSLHAFHIGWP Sbjct: 26 SVPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWP 66 >ref|XP_004243761.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform 1 [Solanum lycopersicum] Length = 475 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 ++PSLP KVWQPGVD LEEGEELQCD SAYNSLHAFHIGWP Sbjct: 26 SVPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWP 66 >ref|NP_001275436.1| glutamate-rich WD repeat-containing protein 1-like [Solanum tuberosum] gi|82400122|gb|ABB72800.1| WD-40 repeat protein-like protein [Solanum tuberosum] Length = 464 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 ++PSLP KVWQPGVD LEEGEELQCD SAYNSLHAFHIGWP Sbjct: 26 SVPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWP 66 >ref|XP_002886033.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297331873|gb|EFH62292.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Length = 470 Score = 85.5 bits (210), Expect = 7e-15 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 IPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 IPS+PT+VWQPGVD LE+GEELQCDPSAYNSLH FH+GWP Sbjct: 24 IPSIPTRVWQPGVDTLEDGEELQCDPSAYNSLHGFHVGWP 63 >ref|NP_179544.1| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] gi|13877611|gb|AAK43883.1|AF370506_1 putative WD-40 repeat protein [Arabidopsis thaliana] gi|4191784|gb|AAD10153.1| putative WD-40 repeat protein [Arabidopsis thaliana] gi|22136272|gb|AAM91214.1| putative WD-40 repeat protein [Arabidopsis thaliana] gi|330251799|gb|AEC06893.1| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] Length = 469 Score = 85.5 bits (210), Expect = 7e-15 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 IPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 IPS+PT+VWQPGVD LE+GEELQCDPSAYNSLH FH+GWP Sbjct: 24 IPSIPTRVWQPGVDTLEDGEELQCDPSAYNSLHGFHVGWP 63 >ref|XP_006580121.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Glycine max] Length = 473 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 117 PSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 P +P KVWQPGVD LEEGEELQCDPSAYNSLHAFHIGWP Sbjct: 30 PEIPAKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWP 68 >ref|XP_006585120.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Glycine max] Length = 474 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 117 PSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 P +P KVWQPGVD LEEGEELQCDPSAYNSLHAFHIGWP Sbjct: 30 PEIPAKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWP 68 >ref|XP_007139165.1| hypothetical protein PHAVU_008G006800g [Phaseolus vulgaris] gi|561012298|gb|ESW11159.1| hypothetical protein PHAVU_008G006800g [Phaseolus vulgaris] Length = 472 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 117 PSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 P +P KVWQPGVD LEEGEELQCDPSAYNSLHAFHIGWP Sbjct: 28 PQIPVKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWP 66 >gb|ACU20888.1| unknown [Glycine max] Length = 108 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 117 PSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 P +P KVWQPGVD LEEGEELQCDPSAYNSLHAFHIGWP Sbjct: 30 PEIPAKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWP 68 >ref|XP_003612352.1| Glutamate-rich WD repeat-containing protein [Medicago truncatula] gi|355513687|gb|AES95310.1| Glutamate-rich WD repeat-containing protein [Medicago truncatula] Length = 455 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -1 Query: 123 TIPSLPTKVWQPGVDNLEEGEELQCDPSAYNSLHAFHIGWP 1 ++P LP KVWQPGVD LEE EELQCDPSAYNSLHAFHIGWP Sbjct: 21 SVPQLPVKVWQPGVDRLEEDEELQCDPSAYNSLHAFHIGWP 61