BLASTX nr result
ID: Cocculus22_contig00003197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00003197 (1021 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844724.1| hypothetical protein AMTR_s00016p00253230 [A... 57 9e-06 >ref|XP_006844724.1| hypothetical protein AMTR_s00016p00253230 [Amborella trichopoda] gi|548847195|gb|ERN06399.1| hypothetical protein AMTR_s00016p00253230 [Amborella trichopoda] Length = 93 Score = 57.4 bits (137), Expect = 9e-06 Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = +2 Query: 287 DEEQNSSQGKYIKRTLSMNEATSPSGGSKTCVCVCAPTTHAGSFKCRLHRVNS----TQS 454 +E ++ + +KRT S + + SG + CVC APTTHAGSF+CRLHRVNS QS Sbjct: 9 EESKDHTPKGTMKRTWSNDSLSGQSGAPRACVC--APTTHAGSFRCRLHRVNSHGHQHQS 66 Query: 455 VPHH 466 HH Sbjct: 67 HHHH 70