BLASTX nr result
ID: Cocculus22_contig00003184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00003184 (2193 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521575.1| abhydrolase domain containing, putative [Ric... 60 3e-06 ref|XP_007202273.1| hypothetical protein PRUPE_ppa008887mg [Prun... 60 4e-06 gb|EXB37262.1| hypothetical protein L484_020321 [Morus notabilis] 59 7e-06 >ref|XP_002521575.1| abhydrolase domain containing, putative [Ricinus communis] gi|223539253|gb|EEF40846.1| abhydrolase domain containing, putative [Ricinus communis] Length = 317 Score = 60.5 bits (145), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 2019 QLGENVTLQGKKKAGHLVHLKRPHVYNRCLKEFL 2120 QLGEN T +G KKAGHLVHL+RP VYNRCLK+FL Sbjct: 274 QLGENATFEGIKKAGHLVHLERPCVYNRCLKKFL 307 >ref|XP_007202273.1| hypothetical protein PRUPE_ppa008887mg [Prunus persica] gi|462397804|gb|EMJ03472.1| hypothetical protein PRUPE_ppa008887mg [Prunus persica] Length = 315 Score = 60.1 bits (144), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 2019 QLGENVTLQGKKKAGHLVHLKRPHVYNRCLKEFL 2120 QLGEN T +G KKAGHLVHL+RP VYNRCLK FL Sbjct: 271 QLGENATFEGIKKAGHLVHLERPCVYNRCLKRFL 304 >gb|EXB37262.1| hypothetical protein L484_020321 [Morus notabilis] Length = 314 Score = 59.3 bits (142), Expect = 7e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 2019 QLGENVTLQGKKKAGHLVHLKRPHVYNRCLKEF 2117 QLG+N T QG KKAGHLVHL+RP VYNRCLK+F Sbjct: 275 QLGDNTTFQGIKKAGHLVHLERPCVYNRCLKQF 307