BLASTX nr result
ID: Cnidium21_contig00036167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036167 (672 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519213.1| DELLA protein RGL1, putative [Ricinus commun... 46 8e-06 >ref|XP_002519213.1| DELLA protein RGL1, putative [Ricinus communis] gi|223541528|gb|EEF43077.1| DELLA protein RGL1, putative [Ricinus communis] Length = 562 Score = 46.2 bits (108), Expect(2) = 8e-06 Identities = 19/34 (55%), Positives = 26/34 (76%) Frame = -1 Query: 108 RFGMVETEFSGASLYQAKLLVDNFSCASSCTFEM 7 RFGM++TE S +SLYQA L++ F C SSCT ++ Sbjct: 506 RFGMIQTELSTSSLYQASLVLKKFPCGSSCTLDV 539 Score = 29.3 bits (64), Expect(2) = 8e-06 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 172 IANIVVFEGEERRMRHV 122 I NIV EGEERR+RHV Sbjct: 479 IRNIVASEGEERRIRHV 495