BLASTX nr result
ID: Cnidium21_contig00035491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035491 (686 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK43722.1| unknown [Medicago truncatula] 72 8e-11 ref|XP_004145431.1| PREDICTED: BAH and coiled-coil domain-contai... 71 2e-10 ref|NP_193945.2| PHD finger and bromo-adjacent homology domain-c... 71 2e-10 gb|AFK46638.1| unknown [Medicago truncatula] 71 2e-10 gb|AFK35634.1| unknown [Lotus japonicus] 71 2e-10 >gb|AFK43722.1| unknown [Medicago truncatula] Length = 172 Score = 72.4 bits (176), Expect = 8e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -1 Query: 686 DRVAVYCKCEMPYNPDDLMVQCEGCKDWHFAMKALHD 576 DRVAVYCKCEMPYNPDDLMVQCEGCKDW+ HD Sbjct: 135 DRVAVYCKCEMPYNPDDLMVQCEGCKDWYHPGLCGHD 171 >ref|XP_004145431.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449487648|ref|XP_004157731.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] Length = 216 Score = 71.2 bits (173), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 686 DRVAVYCKCEMPYNPDDLMVQCEGCKDWH 600 DRVAVYCKCEMPYNPDDLMVQCEGCKDW+ Sbjct: 135 DRVAVYCKCEMPYNPDDLMVQCEGCKDWY 163 >ref|NP_193945.2| PHD finger and bromo-adjacent homology domain-containing protein [Arabidopsis thaliana] gi|332659162|gb|AEE84562.1| PHD finger and bromo-adjacent homology domain-containing protein [Arabidopsis thaliana] Length = 234 Score = 71.2 bits (173), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 686 DRVAVYCKCEMPYNPDDLMVQCEGCKDWH 600 DRVAVYCKCEMPYNPDDLMVQCEGCKDW+ Sbjct: 143 DRVAVYCKCEMPYNPDDLMVQCEGCKDWY 171 >gb|AFK46638.1| unknown [Medicago truncatula] Length = 218 Score = 71.2 bits (173), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 686 DRVAVYCKCEMPYNPDDLMVQCEGCKDWH 600 DRVAVYCKCEMPYNPDDLMVQCEGCKDW+ Sbjct: 135 DRVAVYCKCEMPYNPDDLMVQCEGCKDWY 163 >gb|AFK35634.1| unknown [Lotus japonicus] Length = 216 Score = 71.2 bits (173), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 686 DRVAVYCKCEMPYNPDDLMVQCEGCKDWH 600 DRVAVYCKCEMPYNPDDLMVQCEGCKDW+ Sbjct: 135 DRVAVYCKCEMPYNPDDLMVQCEGCKDWY 163