BLASTX nr result
ID: Cnidium21_contig00023198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00023198 (463 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536384.1| PREDICTED: uncharacterized protein LOC100788... 60 1e-07 ref|XP_003556198.1| PREDICTED: uncharacterized protein LOC100796... 60 2e-07 >ref|XP_003536384.1| PREDICTED: uncharacterized protein LOC100788598 [Glycine max] Length = 573 Score = 60.5 bits (145), Expect = 1e-07 Identities = 34/75 (45%), Positives = 46/75 (61%) Frame = -3 Query: 398 RDAEMDGGDGGLFIGPPPLDVVKETESANEAEHFEEVTPRLTELQLFRLQKDSKYVDVST 219 RDAE+D D LF+GPPP +V E ESANEAE FEEVT ++ ++ DS Y + Sbjct: 247 RDAELDD-DSELFVGPPPPALVSEAESANEAERFEEVT------RIMEVEADSPYDVLGA 299 Query: 218 DQTDASSNLKEKKMK 174 + +S N+K+K K Sbjct: 300 NHNMSSDNMKKKYWK 314 >ref|XP_003556198.1| PREDICTED: uncharacterized protein LOC100796738 [Glycine max] Length = 569 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/75 (45%), Positives = 46/75 (61%) Frame = -3 Query: 398 RDAEMDGGDGGLFIGPPPLDVVKETESANEAEHFEEVTPRLTELQLFRLQKDSKYVDVST 219 RDAE+D D LF+GPPP +V E ESANEAE FEEVT ++ ++ DS Y + Sbjct: 245 RDAELDD-DTELFVGPPPPALVSEAESANEAERFEEVT------RIMEVEADSPYDVLGV 297 Query: 218 DQTDASSNLKEKKMK 174 + +S N+K+K K Sbjct: 298 NHNMSSDNIKKKYWK 312