BLASTX nr result
ID: Cnidium21_contig00019236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00019236 (544 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK61820.1| hypothetical protein [Citrus unshiu] 57 2e-06 >dbj|BAK61820.1| hypothetical protein [Citrus unshiu] Length = 515 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/60 (35%), Positives = 40/60 (66%) Frame = -3 Query: 254 DQEKGDNQEREKIRVQEKGLFEENYRKRSEVMMEYYDKVQGFDGNLENSDGVRKRKSRNI 75 +QEKGD ++K +EK FE N+R + + M+EYY +Q + ++ ++ V+++KSR++ Sbjct: 70 EQEKGDQDAQKKASAEEKSFFEANHRNKKKTMLEYYSNIQDYYAEVQETERVKRKKSRSL 129