BLASTX nr result
ID: Cnidium21_contig00018725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018725 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632750.1| PREDICTED: probable FKBP-type peptidyl-proly... 57 2e-06 ref|NP_001140785.1| uncharacterized protein LOC100272860 [Zea ma... 57 2e-06 >ref|XP_003632750.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 1, chloroplastic isoform 2 [Vitis vinifera] Length = 215 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 9 SGCSTVHYVAKWKNITFMTSRQGLGIGGGT 98 +G +VHYVAKWK ITFMTSRQGLG+GGGT Sbjct: 108 NGLKSVHYVAKWKGITFMTSRQGLGVGGGT 137 >ref|NP_001140785.1| uncharacterized protein LOC100272860 [Zea mays] gi|194701068|gb|ACF84618.1| unknown [Zea mays] gi|414883869|tpg|DAA59883.1| TPA: putative FKBP-type peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 145 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 24 VHYVAKWKNITFMTSRQGLGIGGGTVRL 107 VHYVAKWK ITFMTSRQGLG+GGGTV L Sbjct: 118 VHYVAKWKGITFMTSRQGLGVGGGTVML 145