BLASTX nr result
ID: Cnidium21_contig00008124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00008124 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO39793.1| cysteine inhibitor 1 [Populus balsamifera] 60 1e-07 gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera] gi|226... 60 1e-07 gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera] gi|226... 60 1e-07 ref|XP_002303955.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 gb|AAY41807.1| cysteine proteinase inhibitor [Populus tomentosa] 60 1e-07 >gb|ACO39793.1| cysteine inhibitor 1 [Populus balsamifera] Length = 127 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/40 (77%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 123 MATLGG--STPSSQNSTEIESLARFAVEEHNKKENALLEF 236 MATLGG + SSQNS EI+SLARFAV+EHNKKENA+LEF Sbjct: 20 MATLGGVHDSQSSQNSAEIDSLARFAVDEHNKKENAILEF 59 >gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231580|gb|ACO39783.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231620|gb|ACO39803.1| cysteine inhibitor 1 [Populus balsamifera] Length = 127 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/40 (77%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 123 MATLGG--STPSSQNSTEIESLARFAVEEHNKKENALLEF 236 MATLGG + SSQNS EI+SLARFAV+EHNKKENA+LEF Sbjct: 20 MATLGGVHDSQSSQNSAEIDSLARFAVDEHNKKENAILEF 59 >gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231532|gb|ACO39759.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231534|gb|ACO39760.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231536|gb|ACO39761.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231538|gb|ACO39762.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231540|gb|ACO39763.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231542|gb|ACO39764.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231544|gb|ACO39765.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231546|gb|ACO39766.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231548|gb|ACO39767.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231550|gb|ACO39768.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231552|gb|ACO39769.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231554|gb|ACO39770.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231556|gb|ACO39771.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231558|gb|ACO39772.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231560|gb|ACO39773.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231562|gb|ACO39774.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231564|gb|ACO39775.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231566|gb|ACO39776.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231568|gb|ACO39777.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231570|gb|ACO39778.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231572|gb|ACO39779.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231574|gb|ACO39780.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231576|gb|ACO39781.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231582|gb|ACO39784.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231584|gb|ACO39785.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231586|gb|ACO39786.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231588|gb|ACO39787.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231590|gb|ACO39788.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231592|gb|ACO39789.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231594|gb|ACO39790.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231596|gb|ACO39791.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231598|gb|ACO39792.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231602|gb|ACO39794.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231604|gb|ACO39795.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231606|gb|ACO39796.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231608|gb|ACO39797.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231610|gb|ACO39798.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231612|gb|ACO39799.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231614|gb|ACO39800.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231616|gb|ACO39801.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231618|gb|ACO39802.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231622|gb|ACO39804.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231624|gb|ACO39805.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231626|gb|ACO39806.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231628|gb|ACO39807.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231630|gb|ACO39808.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231632|gb|ACO39809.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231634|gb|ACO39810.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231636|gb|ACO39811.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231638|gb|ACO39812.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231640|gb|ACO39813.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231642|gb|ACO39814.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231644|gb|ACO39815.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231646|gb|ACO39816.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231648|gb|ACO39817.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231650|gb|ACO39818.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231652|gb|ACO39819.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231654|gb|ACO39820.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231656|gb|ACO39821.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231658|gb|ACO39822.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231660|gb|ACO39823.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231662|gb|ACO39824.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231664|gb|ACO39825.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231666|gb|ACO39826.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231668|gb|ACO39827.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231670|gb|ACO39828.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231672|gb|ACO39829.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231674|gb|ACO39830.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231676|gb|ACO39831.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231678|gb|ACO39832.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231680|gb|ACO39833.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231682|gb|ACO39834.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231684|gb|ACO39835.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231686|gb|ACO39836.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231688|gb|ACO39837.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231690|gb|ACO39838.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231692|gb|ACO39839.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231694|gb|ACO39840.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231696|gb|ACO39841.1| cysteine inhibitor 1 [Populus balsamifera] Length = 127 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/40 (77%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 123 MATLGG--STPSSQNSTEIESLARFAVEEHNKKENALLEF 236 MATLGG + SSQNS EI+SLARFAV+EHNKKENA+LEF Sbjct: 20 MATLGGVHDSQSSQNSAEIDSLARFAVDEHNKKENAILEF 59 >ref|XP_002303955.1| predicted protein [Populus trichocarpa] gi|222841387|gb|EEE78934.1| predicted protein [Populus trichocarpa] Length = 235 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/40 (77%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 123 MATLGG--STPSSQNSTEIESLARFAVEEHNKKENALLEF 236 MATLGG + SSQNS EI+SLARFAV+EHNKKENA+LEF Sbjct: 36 MATLGGVHDSQSSQNSAEIDSLARFAVDEHNKKENAILEF 75 >gb|AAY41807.1| cysteine proteinase inhibitor [Populus tomentosa] Length = 143 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/40 (77%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 123 MATLGG--STPSSQNSTEIESLARFAVEEHNKKENALLEF 236 MATLGG + SSQNS EI+SLARFAV+EHNKKENA+LEF Sbjct: 36 MATLGGVHDSQSSQNSAEIDSLARFAVDEHNKKENAILEF 75