BLASTX nr result
ID: Cnidium21_contig00005248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00005248 (553 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK44119.1| unknown [Medicago truncatula] 55 7e-06 ref|XP_002520763.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >gb|AFK44119.1| unknown [Medicago truncatula] Length = 71 Score = 55.1 bits (131), Expect = 7e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -2 Query: 384 WATIELAFKPWLDQARKAMDKSDPSKDPDEIEASPSAPVVDQ 259 W IELAFKP+L Q R ++DKSDP++DPD++ AS +A V + Sbjct: 18 WLAIELAFKPFLSQTRDSIDKSDPTRDPDDVPASAAAAVAPE 59 >ref|XP_002520763.1| conserved hypothetical protein [Ricinus communis] gi|223540148|gb|EEF41725.1| conserved hypothetical protein [Ricinus communis] Length = 69 Score = 54.7 bits (130), Expect = 1e-05 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 2/49 (4%) Frame = -2 Query: 384 WATIELAFKPWLDQARKAMDKSDPSKDPDEIEAS--PSAPVVDQEQPAS 244 W IE+AFKP+LD+AR AMDKSDP +DPD+ PS + ++PA+ Sbjct: 20 WLAIEMAFKPFLDKARAAMDKSDPERDPDDSPPKDLPSDALASDDKPAT 68