BLASTX nr result
ID: Cinnamomum25_contig00041027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00041027 (341 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003834815.1| predicted protein [Leptosphaeria maculans JN... 66 1e-08 ref|XP_007782651.1| hypothetical protein W97_06587 [Coniosporium... 58 2e-06 >ref|XP_003834815.1| predicted protein [Leptosphaeria maculans JN3] gi|312211365|emb|CBX91450.1| predicted protein [Leptosphaeria maculans JN3] Length = 267 Score = 65.9 bits (159), Expect = 1e-08 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 6/68 (8%) Frame = -1 Query: 257 RDPAFWRRFSVAVHQDEEAQLQAARP------ELKHSYVSPSPSMQSPTHHPPSPMATTN 96 RDP FW+RFSVAVHQDE A+ + ++ +LKHSYVS S S +PT P+P + T+ Sbjct: 4 RDPNFWKRFSVAVHQDELAKTEMSQQNTNNHCDLKHSYVSSSRSSSAPT--SPAPASPTS 61 Query: 95 PLSLTSPI 72 P SL SP+ Sbjct: 62 PTSLFSPV 69 >ref|XP_007782651.1| hypothetical protein W97_06587 [Coniosporium apollinis CBS 100218] gi|494830819|gb|EON67334.1| hypothetical protein W97_06587 [Coniosporium apollinis CBS 100218] Length = 99 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 5/40 (12%) Frame = -1 Query: 269 MAMVRDPAFWRRFSVAVHQDEEAQLQA-----ARPELKHS 165 MA+VRDPAFWRRFS+AVH DEEAQ Q+ RP+LKHS Sbjct: 1 MAVVRDPAFWRRFSMAVHMDEEAQTQSTSSSPTRPDLKHS 40