BLASTX nr result
ID: Cinnamomum25_contig00040625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00040625 (377 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD85354.1| hypothetical protein COCHEDRAFT_1024562 [Bipolari... 57 4e-06 ref|XP_007699040.1| hypothetical protein COCSADRAFT_25642 [Bipol... 57 4e-06 ref|XP_007689489.1| hypothetical protein COCMIDRAFT_38131 [Bipol... 57 5e-06 >gb|EMD85354.1| hypothetical protein COCHEDRAFT_1024562 [Bipolaris maydis C5] gi|477583086|gb|ENI00188.1| hypothetical protein COCC4DRAFT_34516 [Bipolaris maydis ATCC 48331] Length = 300 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -3 Query: 363 CAKMAYILPDDRQTKSCNLKADLDFYMCGGEAPG 262 C M+Y+LPDD+QTK+C ++DFY+CGGEAPG Sbjct: 170 CDTMSYVLPDDKQTKTCTQNGNMDFYLCGGEAPG 203 >ref|XP_007699040.1| hypothetical protein COCSADRAFT_25642 [Bipolaris sorokiniana ND90Pr] gi|451851337|gb|EMD64635.1| hypothetical protein COCSADRAFT_25642 [Bipolaris sorokiniana ND90Pr] Length = 284 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 363 CAKMAYILPDDRQTKSCNLKADLDFYMCGGEAP 265 C KM+Y+LPDD QTK+C + A++DFYMCG EAP Sbjct: 171 CDKMSYVLPDDVQTKTCQINANMDFYMCGSEAP 203 >ref|XP_007689489.1| hypothetical protein COCMIDRAFT_38131 [Bipolaris oryzae ATCC 44560] gi|576930428|gb|EUC44010.1| hypothetical protein COCMIDRAFT_38131 [Bipolaris oryzae ATCC 44560] Length = 280 Score = 57.0 bits (136), Expect = 5e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -3 Query: 363 CAKMAYILPDDRQTKSCNLKADLDFYMCGGEAPG 262 C M+Y+LPDD+QTK+C ++DFY+CGGEAPG Sbjct: 168 CDTMSYVLPDDKQTKTCTPNGNMDFYLCGGEAPG 201