BLASTX nr result
ID: Cinnamomum25_contig00040312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00040312 (273 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010249984.1| PREDICTED: uncharacterized protein LOC104592... 57 4e-06 ref|XP_010493095.1| PREDICTED: uncharacterized protein LOC104770... 57 6e-06 ref|XP_006289073.1| hypothetical protein CARUB_v10002476mg [Caps... 57 6e-06 >ref|XP_010249984.1| PREDICTED: uncharacterized protein LOC104592353 [Nelumbo nucifera] Length = 421 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 106 SIMRFRKGSKVEVLSKGELPSGAWRPAEIILGNG 5 +IMRF+KGSKVEVLSK E+PSG+WR AEII GNG Sbjct: 2 AIMRFKKGSKVEVLSKKEVPSGSWRCAEIISGNG 35 >ref|XP_010493095.1| PREDICTED: uncharacterized protein LOC104770379 [Camelina sativa] Length = 326 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 103 IMRFRKGSKVEVLSKGELPSGAWRPAEIILGNG 5 +MRFRKG+KVEVLSK +PSGAWR AEII GNG Sbjct: 1 MMRFRKGTKVEVLSKSSVPSGAWRSAEIISGNG 33 >ref|XP_006289073.1| hypothetical protein CARUB_v10002476mg [Capsella rubella] gi|482557779|gb|EOA21971.1| hypothetical protein CARUB_v10002476mg [Capsella rubella] Length = 326 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 103 IMRFRKGSKVEVLSKGELPSGAWRPAEIILGNG 5 +MRFRKG+KVEVLSK +PSGAWR AEII GNG Sbjct: 1 MMRFRKGAKVEVLSKSSVPSGAWRSAEIISGNG 33