BLASTX nr result
ID: Cinnamomum25_contig00040163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00040163 (288 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534686.1| conserved hypothetical protein [Ricinus comm... 63 9e-08 >ref|XP_002534686.1| conserved hypothetical protein [Ricinus communis] gi|223524770|gb|EEF27700.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 62.8 bits (151), Expect = 9e-08 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -2 Query: 194 MIESRLLVAKPTLFAFLLNQSRSRLLYCSRSGEATASTTAPLPR 63 MIESRLL+AK FAF LNQSRSRLLY SRSGEA+A T APLPR Sbjct: 1 MIESRLLLAKA--FAFFLNQSRSRLLYFSRSGEASAYTRAPLPR 42