BLASTX nr result
ID: Cinnamomum25_contig00039743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00039743 (311 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66740.1| hypothetical protein M569_08032, partial [Genlise... 65 2e-08 ref|XP_009758840.1| PREDICTED: cellulose synthase A catalytic su... 64 5e-08 ref|XP_009629755.1| PREDICTED: cellulose synthase A catalytic su... 64 5e-08 ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic su... 63 7e-08 ref|XP_011090445.1| PREDICTED: cellulose synthase A catalytic su... 63 9e-08 emb|CDP12843.1| unnamed protein product [Coffea canephora] 62 1e-07 ref|XP_012075292.1| PREDICTED: cellulose synthase A catalytic su... 62 1e-07 ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic su... 62 1e-07 ref|XP_012075293.1| PREDICTED: cellulose synthase A catalytic su... 62 1e-07 ref|XP_007048203.1| Cellulose synthase 6 [Theobroma cacao] gi|50... 62 1e-07 gb|AHL45029.1| cellulose synthase 6C [Linum usitatissimum] 61 3e-07 gb|KDO57138.1| hypothetical protein CISIN_1g001369mg [Citrus sin... 61 3e-07 gb|KDO57137.1| hypothetical protein CISIN_1g001369mg [Citrus sin... 61 3e-07 ref|XP_006427905.1| hypothetical protein CICLE_v10024766mg [Citr... 61 3e-07 ref|XP_006427904.1| hypothetical protein CICLE_v10024766mg [Citr... 61 3e-07 gb|AHL45030.1| cellulose synthase 6D [Linum usitatissimum] 61 3e-07 gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea] 60 4e-07 ref|XP_012845220.1| PREDICTED: cellulose synthase A catalytic su... 60 6e-07 ref|XP_007159799.1| hypothetical protein PHAVU_002G268200g [Phas... 60 6e-07 ref|XP_003531396.1| PREDICTED: cellulose synthase A catalytic su... 60 6e-07 >gb|EPS66740.1| hypothetical protein M569_08032, partial [Genlisea aurea] Length = 1015 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRLIAGSHNRNEF+LINADEIGR K +QELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADEIGRIKSVQELSG 36 >ref|XP_009758840.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nicotiana sylvestris] Length = 1094 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 115 LEMATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 + M TGGRLIAGSHNRNEF+LINADEIGR K ++ELSG Sbjct: 1 MAMNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSG 38 >ref|XP_009629755.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nicotiana tomentosiformis] Length = 1094 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 115 LEMATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 + M TGGRLIAGSHNRNEF+LINADEIGR K ++ELSG Sbjct: 1 MAMNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSG 38 >ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nelumbo nucifera] Length = 1095 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRL+AGSHNRNEF+LINADEIGR K ++ELSG Sbjct: 1 MDTGGRLVAGSHNRNEFVLINADEIGRVKSVRELSG 36 >ref|XP_011090445.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] [Sesamum indicum] Length = 1090 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 115 LEMATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 + M TGGRL+AGSHNRNEF+LINADEIGR K + ELSG Sbjct: 1 MAMNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSG 38 >emb|CDP12843.1| unnamed protein product [Coffea canephora] Length = 1093 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRLIAGSHNRNEF+LINAD+IG+ K +QELSG Sbjct: 1 MDTGGRLIAGSHNRNEFVLINADDIGKIKSVQELSG 36 >ref|XP_012075292.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] isoform X1 [Jatropha curcas] Length = 1129 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRL+AGSHNRNEF+LINADE GR K +QELSG Sbjct: 1 MNTGGRLVAGSHNRNEFVLINADESGRIKSVQELSG 36 >ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nelumbo nucifera] Length = 1093 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRL+AGSHNRNEF++INADEIGR K ++ELSG Sbjct: 1 MYTGGRLVAGSHNRNEFVVINADEIGRVKSVKELSG 36 >ref|XP_012075293.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] isoform X2 [Jatropha curcas] gi|643726622|gb|KDP35302.1| hypothetical protein JCGZ_09461 [Jatropha curcas] Length = 1097 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRL+AGSHNRNEF+LINADE GR K +QELSG Sbjct: 1 MNTGGRLVAGSHNRNEFVLINADESGRIKSVQELSG 36 >ref|XP_007048203.1| Cellulose synthase 6 [Theobroma cacao] gi|508700464|gb|EOX92360.1| Cellulose synthase 6 [Theobroma cacao] Length = 1096 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRLIAGSHNRNEF+LINADE GR K +QELSG Sbjct: 1 MDTGGRLIAGSHNRNEFVLINADENGRIKSVQELSG 36 >gb|AHL45029.1| cellulose synthase 6C [Linum usitatissimum] Length = 1097 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRLIAGSHNRNEF+LINADE GR + +QELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADESGRIRSVQELSG 36 >gb|KDO57138.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis] Length = 791 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 MATGGRLIAGSHNRNEF+LINADE R K ++ELSG Sbjct: 1 MATGGRLIAGSHNRNEFVLINADETARIKSVKELSG 36 >gb|KDO57137.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis] Length = 1091 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 MATGGRLIAGSHNRNEF+LINADE R K ++ELSG Sbjct: 1 MATGGRLIAGSHNRNEFVLINADETARIKSVKELSG 36 >ref|XP_006427905.1| hypothetical protein CICLE_v10024766mg [Citrus clementina] gi|557529895|gb|ESR41145.1| hypothetical protein CICLE_v10024766mg [Citrus clementina] Length = 918 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 MATGGRLIAGSHNRNEF+LINADE R K ++ELSG Sbjct: 1 MATGGRLIAGSHNRNEFVLINADETARIKSVKELSG 36 >ref|XP_006427904.1| hypothetical protein CICLE_v10024766mg [Citrus clementina] gi|568820026|ref|XP_006464533.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Citrus sinensis] gi|557529894|gb|ESR41144.1| hypothetical protein CICLE_v10024766mg [Citrus clementina] Length = 1091 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 MATGGRLIAGSHNRNEF+LINADE R K ++ELSG Sbjct: 1 MATGGRLIAGSHNRNEFVLINADETARIKSVKELSG 36 >gb|AHL45030.1| cellulose synthase 6D [Linum usitatissimum] Length = 1097 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRLIAGSHNRNEF+LINADE GR + +QELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENGRIRSVQELSG 36 >gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea] Length = 1086 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 115 LEMATGGRLIAGSHNRNEFILINADEIGRPKPLQELS 5 + M TGGRL+AGSHNRNEF+LINADEIGR K + ELS Sbjct: 1 MAMNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELS 37 >ref|XP_012845220.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like [Erythranthe guttatus] Length = 1088 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 115 LEMATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 + M TGGRL+AGSHNR EF+LINADEIG K +QELSG Sbjct: 1 MAMNTGGRLVAGSHNRKEFVLINADEIGSIKSVQELSG 38 >ref|XP_007159799.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris] gi|561033214|gb|ESW31793.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris] Length = 1097 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRL+AGSHNRNEF+LINADE GR K ++ELSG Sbjct: 1 MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSG 36 >ref|XP_003531396.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Glycine max] gi|734395784|gb|KHN29142.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine soja] Length = 1097 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 109 MATGGRLIAGSHNRNEFILINADEIGRPKPLQELSG 2 M TGGRL+AGSHNRNEF+LINADE GR K ++ELSG Sbjct: 1 MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSG 36