BLASTX nr result
ID: Cinnamomum25_contig00039659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00039659 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008246339.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_010094922.1| hypothetical protein L484_022672 [Morus nota... 57 6e-06 ref|XP_007207191.1| hypothetical protein PRUPE_ppa017094mg [Prun... 57 6e-06 >ref|XP_008246339.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Prunus mume] Length = 601 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/72 (40%), Positives = 41/72 (56%) Frame = -3 Query: 218 PSLNIPNQDPNHQRIQTLLTSLQNCNSIKQAKQIHASILRNGLQHQQDLCAKLLAFCTEP 39 PS +PN + + +L LQ CNS+ + K+IHA ++ NGLQHQ + KLL FC Sbjct: 7 PSQPLPNDVFQASKTKAILALLQGCNSLIKLKKIHAHVITNGLQHQPAISNKLLNFCAVS 66 Query: 38 PSSQLASNSLIY 3 S LA L++ Sbjct: 67 VSGCLAYAQLLF 78 >ref|XP_010094922.1| hypothetical protein L484_022672 [Morus notabilis] gi|587868198|gb|EXB57565.1| hypothetical protein L484_022672 [Morus notabilis] Length = 584 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/65 (40%), Positives = 38/65 (58%) Frame = -3 Query: 197 QDPNHQRIQTLLTSLQNCNSIKQAKQIHASILRNGLQHQQDLCAKLLAFCTEPPSSQLAS 18 Q P + +T+L LQ CNS+K+ ++IHA ++ NGLQH + KLL FC S L Sbjct: 7 QSPESSKAKTILKLLQGCNSLKKLRKIHAFVITNGLQHHPAISTKLLHFCAVSVSGSLPY 66 Query: 17 NSLIY 3 L++ Sbjct: 67 AVLLF 71 >ref|XP_007207191.1| hypothetical protein PRUPE_ppa017094mg [Prunus persica] gi|462402833|gb|EMJ08390.1| hypothetical protein PRUPE_ppa017094mg [Prunus persica] Length = 590 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/72 (40%), Positives = 41/72 (56%) Frame = -3 Query: 218 PSLNIPNQDPNHQRIQTLLTSLQNCNSIKQAKQIHASILRNGLQHQQDLCAKLLAFCTEP 39 PS +PN + + +L LQ CNS+ + K+IHA ++ NGLQHQ + KLL FC Sbjct: 7 PSQPLPNDVFQASKAKAILALLQGCNSLIRLKKIHAYVITNGLQHQTAISNKLLNFCAVS 66 Query: 38 PSSQLASNSLIY 3 S LA L++ Sbjct: 67 VSGCLAYAQLLF 78