BLASTX nr result
ID: Cinnamomum25_contig00039276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00039276 (249 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010247842.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 62 2e-07 >ref|XP_010247842.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8 [Nelumbo nucifera] Length = 881 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/53 (56%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +2 Query: 95 MNGHHSADIADSS--PVSEGERVYFVPYRWLREAQNASVGDAERDKGILYTAS 247 M+ S D AD + P+SE ERVYFVPYRW +EAQ S GD + ++GI+YTAS Sbjct: 1 MDDFASEDRADGAQRPISEDERVYFVPYRWWKEAQEPSSGDGDENRGIVYTAS 53