BLASTX nr result
ID: Cinnamomum25_contig00038991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00038991 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796519.1| PREDICTED: endoribonuclease Dicer homolog 3b... 63 9e-08 >ref|XP_008796519.1| PREDICTED: endoribonuclease Dicer homolog 3b-like [Phoenix dactylifera] Length = 1832 Score = 62.8 bits (151), Expect = 9e-08 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = +3 Query: 12 RINISRNVIFFQHQYFFQTYLDSSTVKNMSFLPAFFLILLPYQGLKPGLVYTRRQIPIHL 191 R+ +SRNV+FF +QYFFQ+ + SS+ +++ LP+F I + KP +VY RRQ P L Sbjct: 140 RLCVSRNVVFFDNQYFFQSNVASSS--DLAMLPSFDDIYHSIKRFKPNIVYKRRQPPQPL 197 Query: 192 ANGPPSPDPLV--VQRSTRSICP 254 ++ P P+P V +RSTR+ P Sbjct: 198 SDTDPPPEPAVPAPRRSTRASHP 220