BLASTX nr result
ID: Cinnamomum25_contig00038986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00038986 (309 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD20888.1| cytochrome oxidase subunit 2 [Ruscus aculeatus] 88 2e-15 ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrio... 86 1e-14 gb|AAB88906.1| cytochrome c oxidase subunit II [Brassica rapa su... 86 1e-14 ref|YP_008964106.1| cytochrome c oxidase subunit 2 (mitochondrio... 86 1e-14 gb|AEX57640.1| cytochrome c oxidase subunit 2-1 (mitochondrion) ... 86 1e-14 gb|AFZ85273.1| cytochrome c oxidase subunit 2 (mitochondrion) [G... 86 1e-14 ref|YP_005090445.1| cytochrome c oxidase subunit 2, partial (mit... 86 1e-14 ref|YP_005090502.1| cytochrome c oxidase subunit 2 (mitochondrio... 86 1e-14 dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Ni... 86 1e-14 ref|NP_064061.2| cox2 gene product (mitochondrion) [Beta vulgari... 86 1e-14 sp|P32646.2|COX2_VIGUN RecName: Full=Cytochrome c oxidase subuni... 85 2e-14 sp|Q02226.1|COXT_SOYBN RecName: Full=Cytochrome c oxidase subuni... 85 2e-14 gb|KHN12912.1| Cytochrome c oxidase subunit 2, mitochondrial [Gl... 85 2e-14 ref|NP_001276209.1| cytochrome c oxidase subunit 2, mitochondria... 85 2e-14 gb|AKJ25591.1| cytochrome c oxidase subunit 2 (mitochondrion) [H... 84 3e-14 dbj|BAI82399.1| cytochrome c oxidase subunit 2 [Beta vulgaris su... 84 3e-14 gb|AFK93572.1| cytochrome c oxidase subunit 2, partial (mitochon... 84 3e-14 emb|CBJ20691.1| cytochrome c oxidase subunit 2 [Beta vulgaris su... 84 3e-14 ref|YP_006460161.1| cytochrome c oxidase subunit II (mitochondri... 84 4e-14 gb|AKJ25571.1| cytochrome c oxidase subunit 2 (mitochondrion) [C... 84 5e-14 >emb|CAD20888.1| cytochrome oxidase subunit 2 [Ruscus aculeatus] Length = 258 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVSLKDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSLKDYGSWVSNQL 253 >ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gi|2687657|gb|AAB88867.1| cytochrome c oxidase subunit II [Raphanus sativus] gi|400278265|dbj|BAM36189.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gi|400278309|dbj|BAM36232.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] Length = 260 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQL 253 >gb|AAB88906.1| cytochrome c oxidase subunit II [Brassica rapa subsp. oleifera] Length = 260 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQL 253 >ref|YP_008964106.1| cytochrome c oxidase subunit 2 (mitochondrion) (mitochondrion) [Ajuga reptans] gi|558697219|gb|AHA84973.1| cytochrome c oxidase subunit 2 (mitochondrion) [Ajuga reptans] Length = 255 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQL 253 >gb|AEX57640.1| cytochrome c oxidase subunit 2-1 (mitochondrion) [Raphanus sativus] Length = 260 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQL 253 >gb|AFZ85273.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] gi|429465287|gb|AFZ85274.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] gi|429465290|gb|AFZ85275.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] Length = 260 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQL 253 >ref|YP_005090445.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Millettia pinnata] gi|370288191|gb|AET62905.2| cytochrome c oxidase subunit 2, partial (mitochondrion) [Millettia pinnata] Length = 260 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 211 VQREGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQL 252 >ref|YP_005090502.1| cytochrome c oxidase subunit 2 (mitochondrion) [Lotus japonicus] gi|357197366|gb|AET62962.1| cytochrome c oxidase subunit 2 (mitochondrion) [Lotus japonicus] Length = 257 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 211 VQREGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQL 252 >dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Nicotiana tabacum] Length = 260 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQL 253 >ref|NP_064061.2| cox2 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435041|ref|YP_004222256.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|346683134|ref|YP_004842063.1| cytochrome c oxidase subunit 2 [Beta macrocarpa] gi|87248025|gb|ABD36067.1| cytochrome oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|148491430|dbj|BAA99453.2| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905694|emb|CBJ14086.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|319439774|emb|CBJ17495.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|345500052|emb|CBX24868.1| cytochrome c oxidase subunit 2 [Beta macrocarpa] gi|384939216|emb|CBL52062.2| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 260 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQL 253 >sp|P32646.2|COX2_VIGUN RecName: Full=Cytochrome c oxidase subunit 2, mitochondrial; AltName: Full=Cytochrome c oxidase polypeptide II; Flags: Precursor, partial [Vigna unguiculata] gi|6626170|gb|AAF19523.1|AF211254_1 cytochrome c oxidase subunit 2, partial [Vigna unguiculata] Length = 376 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 ++REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQ+ Sbjct: 334 IQREGVYYGQCSEICGTNHAFMPIVVEAVSTKDYGSWVSNQI 375 >sp|Q02226.1|COXT_SOYBN RecName: Full=Cytochrome c oxidase subunit 2, mitochondrial; AltName: Full=Cytochrome c oxidase polypeptide II; Flags: Precursor gi|18570|emb|CAA78032.1| cytochrome oxidase subunit 2 [Glycine max] Length = 394 Score = 84.7 bits (208), Expect = 2e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQLN 181 ++REGVYYGQCS ICGTNHAFMPIV+EAVS KDYGSWVS+Q+N Sbjct: 352 IQREGVYYGQCSEICGTNHAFMPIVIEAVSTKDYGSWVSSQVN 394 >gb|KHN12912.1| Cytochrome c oxidase subunit 2, mitochondrial [Glycine soja] Length = 376 Score = 84.7 bits (208), Expect = 2e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQLN 181 ++REGVYYGQCS ICGTNHAFMPIV+EAVS KDYGSWVS+Q+N Sbjct: 334 IQREGVYYGQCSEICGTNHAFMPIVIEAVSTKDYGSWVSSQVN 376 >ref|NP_001276209.1| cytochrome c oxidase subunit 2, mitochondrial-like [Glycine max] gi|255647170|gb|ACU24053.1| unknown [Glycine max] Length = 376 Score = 84.7 bits (208), Expect = 2e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQLN 181 ++REGVYYGQCS ICGTNHAFMPIV+EAVS KDYGSWVS+Q+N Sbjct: 334 IQREGVYYGQCSEICGTNHAFMPIVIEAVSTKDYGSWVSSQVN 376 >gb|AKJ25591.1| cytochrome c oxidase subunit 2 (mitochondrion) [Hypseocharis bilobata] Length = 267 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQ 187 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQ Sbjct: 221 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQ 261 >dbj|BAI82399.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] Length = 252 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQ 187 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQ Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQ 252 >gb|AFK93572.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Magnolia tripetala] Length = 235 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 VKREGVYYGQCS ICGTNHAFMPIVVEAVSLKDYGS VSNQL Sbjct: 193 VKREGVYYGQCSEICGTNHAFMPIVVEAVSLKDYGSRVSNQL 234 >emb|CBJ20691.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] Length = 252 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQ 187 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDYGSWVSNQ Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQ 252 >ref|YP_006460161.1| cytochrome c oxidase subunit II (mitochondrion) (mitochondrion) [Erythranthe guttata] gi|340007652|gb|AEK26516.1| cytochrome c oxidase subunit 2 (mitochondrion) (mitochondrion) [Erythranthe guttata] Length = 260 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAV KDYGSWVSNQL Sbjct: 212 VQREGVYYGQCSEICGTNHAFMPIVVEAVPRKDYGSWVSNQL 253 >gb|AKJ25571.1| cytochrome c oxidase subunit 2 (mitochondrion) [California macrophylla] Length = 257 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 309 VKREGVYYGQCSAICGTNHAFMPIVVEAVSLKDYGSWVSNQL 184 V+REGVYYGQCS ICGTNHAFMPIVVEAVS KDY SWVSNQL Sbjct: 214 VQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYASWVSNQL 255