BLASTX nr result
ID: Cinnamomum25_contig00038945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00038945 (399 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_042854722.1| hypothetical protein, partial [Staphylococcu... 69 2e-09 gb|ACU23657.1| unknown [Glycine max] 63 7e-08 gb|AEZ48936.1| clp protease proteolytic subunit, partial [Potaro... 59 2e-06 >ref|WP_042854722.1| hypothetical protein, partial [Staphylococcus aureus] Length = 121 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +3 Query: 282 EPYAPKGACTVPKE*NFVLINRLYRERLLFLGQEVDSEI 398 EPYA KGACT K NF+LINRLYRERLLFLGQEVDSEI Sbjct: 4 EPYASKGACTATKGYNFILINRLYRERLLFLGQEVDSEI 42 >gb|ACU23657.1| unknown [Glycine max] Length = 124 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = +3 Query: 282 EPYAPKGACTVPKE*NFVLINRLYRERLLFLGQEVDSEI 398 E YA KGACT KE N +LINRLYRERLLFLGQEVDSEI Sbjct: 5 ELYASKGACTALKEKNGILINRLYRERLLFLGQEVDSEI 43 >gb|AEZ48936.1| clp protease proteolytic subunit, partial [Potarophytum riparium] Length = 214 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 285 PYAPKGACTVPKE*NFVLINRLYRERLLFLGQEVDSEI 398 PYA KGA V K FVLINRLYRERLLFLGQEVDSEI Sbjct: 24 PYASKGARMVSKGYYFVLINRLYRERLLFLGQEVDSEI 61