BLASTX nr result
ID: Cinnamomum25_contig00038915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00038915 (350 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 109 6e-22 emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 70 4e-13 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 109 bits (273), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -2 Query: 229 YVTSSRPRCIEEYLCTMFRFTDKEDRVGVGVYDVILKDDPGRYMLTMGRKQEPFCQ 62 Y+TSSRPRCIEEYLCTMFRFTDKEDRV VGVY+VILK DPGRYMLTMGRKQEP C+ Sbjct: 376 YITSSRPRCIEEYLCTMFRFTDKEDRVRVGVYNVILKYDPGRYMLTMGRKQEPLCK 431 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 70.5 bits (171), Expect(2) = 4e-13 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 168 VNRNIVHRYSSMQRGRDDVTYYDHVQKCCP 257 VNRNIVHRYSSMQRGRDDVTYYDHVQKCCP Sbjct: 342 VNRNIVHRYSSMQRGRDDVTYYDHVQKCCP 371 Score = 30.4 bits (67), Expect(2) = 4e-13 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 263 ARQYGTSQLLPFLY 304 ARQYGTSQ LPFLY Sbjct: 373 ARQYGTSQQLPFLY 386